KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_0204Help
Entry
STMUK_0204        CDS       T01743                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00860  Porphyrin and chlorophyll metabolism
sej01100  Metabolic pathways
sej01110  Biosynthesis of secondary metabolites
sej01120  Microbial metabolism in diverse environments
Module
sej_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
sej_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sej00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STMUK_0204 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sej01007]
    STMUK_0204 (hemL)
Enzymes [BR:sej01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     STMUK_0204 (hemL)
Amino acid related enzymes [BR:sej01007]
 Aminotransferase (transaminase)
  Class III
   STMUK_0204 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEF06137
Position
complement(237204..238484)
Genome map
AA seq 426 aa AA seqDB search
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLTSVRAAFEQYPQEIASIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLCEAAQEAGIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFEAGFMSVAHSMDDINNTIDAAR
RVFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctgaaaatctctatagcgcggcccgcgagctgatccccggcggcgtgaac
tcccctgttcgcgccttcactggcgtgggcggcaccccgctgtttatcgaaaaagcggac
ggcgcttatctttatgatgtcgatggcaaagcgtatatcgactatgtcggttcctgggga
ccaatggtactggggcataaccatccggctatccgcaatgcggtgatcgaagctgcggag
cgcggtttaagcttcggcgcgccaaccgaaatggaagtgaaaatggcggaactggtcacc
aacctggtgccgaccatggacatggtgcgcatggtgaactccggcaccgaagcgacgatg
agcgctattcgcctggcgcgtggttttactggccgcgataagattatcaaattcgaaggc
tgctaccacggccacgcagactgtctgctggtcaaagccggttctggcgcgctgacgctc
ggtcagccgaactcgccgggcgtgccggcagatttcgcgaaacatacgctgacctgcact
tataacgatctgacgtcagtgcgcgcggcatttgaacaatatccgcaggaaatcgccagt
atcatcgtcgaacccgtggcgggcaatatgaactgcgtcccgccgctgccggaatttctg
ccaggtctgcgcgccttgtgcgatgagttcggcgcgctgctgattatcgacgaagtaatg
accggttttcgcgtagcgctggccggagcccaggattactacggcgtcgtgccggacctg
acctgtctgggtaaaatcatcggcggcgggatgccggtaggcgcgtttggcggtcgtcgc
gatgtaatggatgcgctggcgccgacgggcccggtttaccaggcgggcaccctttccggc
aacccgattgcgatggcggccggtttcgcctgcctgaatgaagtcgcccagcccggcatt
catgaaacgctggatgagctcaccacccgcctggcggaagggctgtgcgaagcggcgcag
gaggcggggatcccactggtcgtcaaccatgtcggcggcatgttcgggattttcttcacc
gacgctgagagcgtaacctgctatcaggacgtgatggcgtgcgacgtggaacgctttaag
cgtttcttccacctgatgctggaggaaggcgtatatctggcgccatcggcgtttgaggcg
ggctttatgtcggtcgcacacagcatggacgacattaataatactattgacgccgcgcgt
cgggtgtttgcgaaactgtaa

DBGET integrated database retrieval system