KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_0268
Entry
STMUK_0268        CDS       T01743                                 

Definition
(GenBank) putative cytoplasmic protein
  KO
K11902  type VI secretion system protein ImpA
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Brite
KEGG Orthology (KO) [BR:sej00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sej02044]
    STMUK_0268
Secretion system [BR:sej02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMUK_0268
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AEF06194
UniProt: A0A3Z6P2Q2
Position
complement(304654..305709)
AA seq 351 aa
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDAR
RLLTRSKDIRVLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAES
IEDASLARSNALAALLDHEGVMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPES
VRQQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAPDFSRLRQLLALLPDVVQT
TTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISLPHNAEPGPIRDRNDALER
LRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggacatgtccctgactaaaccggtaagcgcggaacaaccctgcggccccgatccggag
tacgatccggaatacctgctgctgttcagccgcgccgccccccaggcggaggcgcaatat
ggtgattttgtcagtacgccggaagccgtgaactggccggaaattgaacgtgatgcgcgc
cgtctgctcacgcgcagtaaggatatccgggtgttgatcctgctgctgcgcagtcgcatc
cagcaggctggcgcacagggactggcggaaatgctcacacaactggcagaactgagcgta
atctggtctgatgcactccatccacagctgcttaccggcgaaggcgcatccgcagaatct
attgaagatgcgtcgctggcgcgcagtaatgccctggcggcgctgctggatcacgaaggc
gtgatggcggacattcgcggtattacgctgtcaaacagtgccgccctgcgcctacaggta
cgggatgtggagcgcgcgttatccgctccccgcccggctgatgcgctggcccccgaatcc
gtccgccagcaactggccgacctcgaagcccgtggggcattaccgctggcggcgtttcgc
gaagcgcaggaaagcgcagaacgcctgcaagtgtgggcgcgtgagacattaggcgatctg
gctccagatttttcacgcctgcggcagttgttagcgctgctgcctgacgtggtacagaca
accacaccggaaatccctccgtcgccagcgccagtgccagaccccgcaggcacggttatg
gataatgccgttccggcacgggcagaggatgtgccgcctgtcaacgcgccacccggtata
tccctcccacacaatgctgaaccggggccaattcgcgatcgtaatgatgcgctggaacgc
ctgcggtgcattcgtcgctggtttgagagcagtgaacccagtagcccgaccatcccactg
ttacgccaggctgaaagactggtgggaaaacggttctcggaggtgatcaatgagatcccg
gtggagttgctggagaagtgggatgccctggagtga

DBGET integrated database retrieval system