KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_0279
Entry
STMUK_0279        CDS       T01743                                 

Definition
(GenBank) putative cytoplasmic protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sej00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STMUK_0279
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sej02044]
    STMUK_0279
Secretion system [BR:sej02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMUK_0279
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEF06205
UniProt: A0A6C7AHL0
Structure
PDB: 
5XHH

Position
316867..317352
AA seq 161 aa
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcttatgacatttttttgaaaattgacggcattgatggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcaccaacctggattttgatcac
tatatcgaccgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggtggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtggagctctccttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggcggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system