KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_2778Help
Entry
STMUK_2778        CDS       T01743                                 

Gene name
ygaF
Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00310  Lysine degradation
sej01100  Metabolic pathways
sej01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    STMUK_2778 (ygaF)
Enzymes [BR:sej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     STMUK_2778 (ygaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 FAD_binding_2 Thi4 Trp_halogenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AEF08649
Position
2907332..2908600
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNQATKTFCDQNNIRYDTCGKMLVATSELEMARMRALWERTAANGLEREWLS
AAELREREPNIIGLGGIFVPSSGIVSYRDVATAMANRFQAKGGEIIYHAEVSALTEHAAG
VVIRTSQGREIETATLIGCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPRHNRIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDVSFTDTLEIFRSAGIRR
VLQNHLLSGLGEMKNSLCKSGYLRRVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRASQSNPGRTLRAARSVDALHAAF
TR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattatcggcggcggcattatcggcatgtcgaccgccatgcaactt
attgatgtctacccggatgcgcgcatcgcgttgctggaaaaagagtccgcgccagcctgc
caccagaccgggcataacagcggcgtgatccatgccggggtgtactacacgcccggcagc
ctcaaagcgcagttttgtctggcaggcaatcaggcgaccaaaaccttttgcgatcaaaac
aacatccgctacgacacctgcggcaaaatgttggtcgccacctcggagctggaaatggcg
cggatgcgcgcgctatgggagcggacggcggccaacggcttagagcgcgagtggttaagc
gcggcggagctgcgtgaacgcgaacccaatatcattggcctgggcgggatttttgtccct
tccagcgggattgtcagctatcgcgatgtcgcgacggccatggcgaaccgctttcaggcc
aaaggcggcgagatcatctaccatgccgaggtcagcgcgctaacagaacatgccgctggc
gttgtcattcgcacctcgcaaggtcgggaaatagaaaccgctacgcttatcggctgtgca
ggactgatggcggatcggctggtcaaaatgctgggcgtggagcccggttttattatctgc
cctttccgcggcgagtactttcgtctggccccgcgacacaaccggatcgttaaccatttg
atctacccgatccccgatccggcaatgccgtttctcggcgtccatcttacccgcatgatc
gacggcagcgttacggtcgggccgaatgcggtgctggcgcttaaacgcgaaggctaccgt
aagcgcgacgtttccttcaccgacaccctggagattttccgctccgccggcattcgccgc
gtactgcaaaaccatctgctttccggactgggcgagatgaaaaactcgctgtgcaaaagc
ggctatttgcggcgagtacaaaagtattgccccagcctgaccgtcaacgatctccagccc
tggccggcaggcgtgcgggcgcaggcggtttcaccggacggcaaactgattgatgatttt
ctgtttgtcacaacgccgcgttccattcacacctgtaacgccccctccccggcggcgaca
tccgcgatacctatcggcgcgcatatcgtcagcaaagttcaggcgctacgcgcaagccag
agcaaccccggacgtacgctgcgtgcggcacgcagcgtggacgcattacacgccgcattt
acccgttaa

DBGET integrated database retrieval system