KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_4333Help
Entry
STMUK_4333        CDS       T01743                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00564  Glycerophospholipid metabolism
sej01100  Metabolic pathways
sej01110  Biosynthesis of secondary metabolites
Module
sej_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sej00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    STMUK_4333 (psd)
Enzymes [BR:sej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     STMUK_4333 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: AEF10145
Position
complement(4553015..4553983)
Genome map
AA seq 322 aa AA seqDB search
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMTEAQKPDTASY
RTFNDFFVRPLRDDVRPLNTDPNILVMPADGVISQLGRIEEDKILQAKGHNYSLEALLAG
NYLMADKFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGIIKRWTWPEGEHEGSVA
LLKGQEMGRFKLGSTVINLFAPGKVNLIASLASLSVTKIGQPLATSTETFVAPEVEPAPL
PAEEIKAEHDASPLVDNKKDDT
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaactcatttaaactttcgctacaatacattctgccgaaactatggctcactcgc
ctggcgggctggggcgcaagcaaacgagcaggatggctgacaaaactggttatcgatctc
ttcgtaaagtattacaaagtcgatatgaccgaggcgcaaaaaccggataccgccagctat
cgtacgttcaatgatttctttgttcgtccgctgcgtgatgacgtgcgtccgctcaatacc
gatcctaacatcctggtgatgcctgccgacggcgtgataagccagttgggtcgtatcgaa
gaagataaaattttgcaggccaaaggccataattacagccttgaggcgttgctggcgggt
aactacctgatggcggataagttccgcaacggcacgtttgtgaccacttacctctcccct
cgcgactaccatcgcgtgcatatgccatgcaacggcatcctgcgtgaaatgatctacgta
ccgggcgatctgttctccgttaaccatctgaccgcgcaaaacgtccccaacctgtttgcc
cgcaacgagcgcgttatctgcctgtttgataccgagttcggccctatggcgcagattctg
gtcggcgcaactattgtcggcagtatcgaaaccgtctgggcggggaccattaccccgccg
cgcgaaggcatcatcaagcgctggacctggccagaaggcgaacatgaagggtctgtcgcc
ctgttgaaaggccaggagatgggacgctttaaactgggttccacggtcatcaacttattt
gcgccgggaaaagtgaatctgatcgcgtcgctggcaagcctgtccgttaccaaaattggc
caaccgctggcgacgtcgaccgaaacattcgtcgcgccggaggtagaacctgctccgctg
ccggcagaagaaattaaagccgaacacgacgccagcccgctggttgacaataaaaaagac
gacacctaa

DBGET integrated database retrieval system