KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_4462Help
Entry
STMUK_4462        CDS       T01743                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00230  Purine metabolism
sej00240  Pyrimidine metabolism
sej01100  Metabolic pathways
sej03030  DNA replication
sej03430  Mismatch repair
sej03440  Homologous recombination
Module
sej_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sej00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STMUK_4462 (holC)
   00240 Pyrimidine metabolism
    STMUK_4462 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STMUK_4462 (holC)
   03430 Mismatch repair
    STMUK_4462 (holC)
   03440 Homologous recombination
    STMUK_4462 (holC)
Enzymes [BR:sej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STMUK_4462 (holC)
DNA replication proteins [BR:sej03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STMUK_4462 (holC)
DNA repair and recombination proteins [BR:sej03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     STMUK_4462 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AEF10268
Position
complement(4680306..4680788)
Genome map
AA seq 160 aa AA seqDB search
MTTHLNPPQEAPYMKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEK
QAIRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFA
TAFTEVVDFVPYEETLKQLARERYKAYRVAGFNLNTATWK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcatttaaatccaccacaagaagccccatatatgaaaaatgcgacgttctat
cttctggataatgacaccaccgtcaacggtttaagcgccgttgaacaactggtgtgtgaa
attgccgcagaacgttggcgcgcgggcaagcgcgtgctgatcgcctgcgaagatgagaag
caggccattcggctggatgaagcgctgtgggcaagaccggcggaaagttttgtcccgcac
aatctggcaggcgaaggcccacgcggcggcgcgccggttgaaatcgcctggccgcaaaaa
cgcaacagcagcccgcgcgatattttaatcagcctgcgtacaagctttgcagattttgcc
accgctttcacagaagtggtagacttcgtcccttacgaagaaactttgaaacaactggcg
cgcgaacgctacaaagcctaccgcgtggctggttttaacctgaatacggcaacctggaaa
taa

DBGET integrated database retrieval system