KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0134Help
Entry
SSPA0134          CDS       T00756                                 

Definition
(GenBank) preprotein translocase SecA subunit
  KO
K03070  preprotein translocase subunit SecA
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek02024  Quorum sensing
sek03060  Protein export
sek03070  Bacterial secretion system
Module
sek_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SSPA0134
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SSPA0134
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SSPA0134
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sek02044]
    SSPA0134
Secretion system [BR:sek02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   SSPA0134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD DUF2175 DUF2764
Motif
Other DBs
NCBI-ProteinID: CAR58245
UniProt: B5BLD0
Position
160234..162939
Genome map
AA seq 901 aa AA seqDB search
MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKAKTNEFRARIEKGESV
ESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRTGEGKTLTATLPAYLNA
LSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPAPAKREAYAADITYGTNN
EYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKKVN
KIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVLIEELLVQEGIMDEGESLYS
PGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK
EGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR
KDLPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTISIEKSEVVSRELTKAGIKHNVLN
AKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGGSWQAEVAALEAPTEEQIAQIKAD
WQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSMEDALMRIFAS
DRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY
TQRNELLDVSDVSDTINSIREDVFKATIDAYIPPQSLEEMWDILGLQERLKNDFDLEMPI
AEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLA
AMDYLRQGIHLRGYAQKDPKQEYKRESFAMFAAMLESLKYEVISTLSKVQVRMPEEVEAM
EMQRREEAERLAQMQQLSHQDDDAAVAADLAAQTGERKIGRNDPCPCGSGKKYKQCHGRL
S
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcaaattattaaccaaagtattcggtagccgtaacgatcgtacgctgcgtcgt
atgcgtaaggccgtcagccttattaatgcgatggaaccggagatggaaaaactctccgat
gacgaactgaaagcgaaaaccaacgaatttcgcgcccgtattgaaaaaggcgaaagcgta
gagagcctgattccggaagcgttcgcggtggtgcgtgaagccagtaaacgcgtctttggg
atgcgtcacttcgacgttcagctattgggtggtatggtgctcaacgatcgctgtatcgcc
gaaatgcgtactggtgaaggtaaaacgctgaccgcaacgctgccagcctacctgaacgcg
ttgtccggcaaaggcgttcatgtggtaaccgtgaacgactatctggcgcagcgtgacgcc
gaaaacaaccgtccgctattcgaattcctcggtatgtccgttggtatcaacctgccaggt
atgcctgcgccagccaaacgtgaagcttacgctgccgacatcacttacggcactaacaac
gaatacggttttgactacctgcgcgacaacatggcattcagcccggaagagcgcgtgcag
cgtaaactgcattatgcgctggtggatgaagtcgactccatcctgatcgatgaagcgcgt
acgccgctgattatttccggcccggcggaagatagctcggaaatgtacaaaaaagtgaac
aaaatcattccgcacctgattcgtcaggagaaagaagattctgacactttccagggcgaa
ggccacttctccgttgatgagaaagcgcgccaggttaacctgaccgaacgcggtctggtg
ctgattgaagagctactggtgcaagaaggcattatggatgaaggcgagtcgctctactcg
cctggcaatattatgctgatgcatcacgtcaccgccgcgctgcgcgcgcacgcgctgttt
acccgtgacgtggattacattgtgaaagacggcgaagtcatcattgttgatgaacatacc
ggtcgtaccatgcaggggcgtcgctggtctgacggtctgcaccaggcggtagaagcgaaa
gaaggcgttgaaattcagaatgaaaaccagacgctggcgtctattaccttccagaactac
ttccgtctgtatgaaaagctggccggtatgaccggtacggcggatactgaagccttcgaa
tttagctctatctataagctggacaccgtcgttgttccgaccaaccgtccgatgatccgt
aaagatttgccggatctggtctacatgaccgaagcggaaaaaatccaggccattatcgaa
gatattaaagaacgtaccgcgaacggtcagccagtgctggtcgggacgatttctatcgag
aaatctgaagtggtctccagagagctgaccaaagcgggcatcaaacataacgtactgaac
gcaaaattccacgccaacgaagcaggcatcgttgcgcaggctggttatccagcggcggtc
actatcgctactaacatggcgggtcgtggtaccgatattatgctgggcggtagctggcag
gcggaagtcgccgcgctggaagcgccgacggaagaacagattgcgcagattaaagcggac
tggcaggtacgccatgacgcggttctagctgccggtggtctgcatatcattggcaccgag
cgccatgaatcccgccgtatcgacaaccagctgcgtggccgttccggtcgccagggcgat
ccgggttcttcccgtttctatctgtcgatggaagatgcgctgatgcgtattttcgcctcc
gatcgtgtctccggtatgatgcgtaaactggggatgaagccgggcgaagcgattgagcac
ccgtgggtgacgaaagctatcgctaacgcgcagcgtaaagtagaaagccgtaacttcgat
attcgtaagcaactgctggaatatgatgatgtggcgaacgatcagcgccgtgcaatttat
acccagcgtaacgaactgctggatgtgtctgacgtgagcgacaccattaacagcattcgc
gaagatgtctttaaggcgactatcgacgcctacattccgccgcagtcgctggaagagatg
tgggacatcctgggtttgcaagaacgcctgaaaaacgacttcgacttggagatgccgatt
gccgaatggctggataaagagccggagctacatgaggagacgctgcgtgagcgcatcctg
gcgcagtccatcgaggtgtatcagcgtaaagaagaggtggttggcgctgaaatgatgcgt
catttcgaaaaaggcgtgatgctgcaaacgctcgattccctgtggaaagagcatctggcg
gcgatggattacctgcgtcagggtattcatctgcgcggctatgcgcaaaaagatccgaag
caggaatacaagcgcgaatccttcgctatgttcgccgcgatgctggaatcgctgaaatat
gaagtgatcagtaccctgagcaaagtccaggtacgtatgcctgaagaggtcgaagcgatg
gaaatgcagcgtcgcgaagaggcggagcgactggcgcagatgcagcagctaagccatcag
gatgacgatgccgccgtggctgccgatctggccgcccaaacaggcgaacgtaagattgga
cgtaacgatccttgcccgtgcggttccggtaagaaatacaaacagtgtcacggtcgcctg
agctaa

DBGET integrated database retrieval system