KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0136Help
Entry
SSPA0136          CDS       T00756                                 

Definition
(GenBank) putative aldo/keto reductase
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: CAR58247
Position
complement(163520..164509)
Genome map
AA seq 329 aa AA seqDB search
MQYRTLGANGPRVSAIGLGCMGMSAFYGAHDDSTSIKTLHYALDQGVTLLDTADMYGPYT
NERLVGKAIADRRDRVFLATKFGIVLDPANPMARGVNGRPEYVRRSCEQSLQRLGVDHID
LYYQHRVDPSVPIEETVGAMADLVREGKVRYLGLSEASTQTLERAHNVHPITALQSEYSL
WSREAEISALSTCERLGIGFVAYSPLGRGFLTGTIKTPEDFAANDFRRTNPRFMGESFSR
NLRLAEAIKQMAREKECTPAQLALAWLLARNRHIVPIPGTRHCARVDENLGALSLTLSPQ
ELTAIEAVFPHDTAAGPRYWPEIMSTLNR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcgtacattaggcgcaaacggaccgcgagtgtcagccatcggactgggatgt
atgggcatgagcgcattttacggcgctcatgacgacagcacctcaattaagacgctacat
tatgcgttagatcagggggtaacactgctcgataccgcagatatgtatggcccttatacc
aatgaaaggttagtcggaaaagccatcgccgatcgtcgcgatcgggtatttttagcgacg
aaatttggtatcgttctcgaccctgctaaccctatggcgcgtggcgtcaatggcagaccg
gagtacgttcgccgtagttgtgagcaaagcctgcaacgcctgggggtcgatcatatcgat
ctgtactatcaacatcgcgttgatccatcagttcccatagaagagactgtcggtgcaatg
gcggacctggtgcgcgagggaaaagtgcgttatctcgggctatccgaagcatcaacgcaa
acgctggaacgcgcccataacgttcaccctattaccgcgctgcaaagtgagtattcgctt
tggtcccgcgaagcggaaatttcagcactttccacctgtgaacggttgggtataggattc
gtcgcttacagcccgctgggacgcggatttctgaccggtacgattaaaacgccagaagat
tttgctgcgaatgacttccgtcgcacaaatcccaggttcatgggtgagagcttctcgcgc
aatttacgtctggctgaagcaataaaacaaatggcacgcgaaaaagagtgtacccccgca
caattagcgctggcctggctgctggcccgcaacaggcacatcgttcccattcccggcacc
cgccactgcgccagggtggatgaaaacctcggcgcgttatcactgaccctaagcccgcag
gagctgacggcaattgaggcggtttttcctcacgacaccgcggccggcccccgctactgg
ccggaaattatgtcgacattaaatcgctaa

DBGET integrated database retrieval system