KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0140Help
Entry
SSPA0140          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00770  Pantothenate and CoA biosynthesis
sek01100  Metabolic pathways
Module
sek_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SSPA0140
Enzymes [BR:sek01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     SSPA0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoaE AAA_33 AAA_28 AAA_29 AAA_18 AAA_17 SKI Cytidylate_kin2 AAA_16 DUF348 ABC_tran AAA_22
Motif
Other DBs
NCBI-ProteinID: CAR58251
Position
complement(166477..167097)
Genome map
AA seq 206 aa AA seqDB search
MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQPALNAIAEHFGSELIA
ADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQQQFQQATSPYVLWVVPLLVENRL
YQKANRVLVVDVMPETQLIRTMQRDDVTREHVEHILAAQATREARLAVADDVIDNNGAPD
AIASDVARLHASYLKLASQFVSQEKP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataccgtagccttaaccggcggtattggcagcggtaaaagtaccgtcgctgat
gccttcgctgacctcggaataaccgtcatcgacgcggatattatcgcgcgccagatggtt
gagccagggcagcccgccctgaacgcaatagcggaacattttggttctgaacttatcgcc
gccgacggcacgttacgtcgccgggcgctgcgtgagcgtattttttcgcatccggaagaa
aaagcctggcttaacgctctgcttcatcccttaattcagcaggaaacccaacaacagttt
caacaggctacgtcgccctatgtgttatgggttgtgcctctgctggttgaaaacaggctg
tatcaaaaagccaaccgcgtactggtggttgacgtgatgcccgaaacgcaactcatacgc
acaatgcagcgtgatgatgttacgcgcgagcatgttgaacacattctcgctgcgcaggcg
acgcgtgaagcgcgccttgccgtggcggacgatgttattgataataacggcgcaccggat
gctatcgcatcagatgtggcccgcctgcacgccagttatcttaagctcgcgtcgcagttt
gtctcacaggaaaaaccgtaa

DBGET integrated database retrieval system