KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0148Help
Entry
SSPA0148          CDS       T00756                                 

Definition
(GenBank) putatuve glycosysl hydrolase
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CAR58259
Position
complement(174130..175080)
Genome map
AA seq 316 aa AA seqDB search
MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRANSLEGLRAADPVVVWRKPK
TGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRMFALECADADPLTGKWTEK
GQIKTPFDTFALDATTFYHQGKQWYLWAQKAPDIAGNSNIYLAELENPWTIKGEPVRLSK
PEYDWECRGFWVNEGPAVVVHGDKLFISYSASATDENYCMGLLWINVNDDPLTPQNWHKS
PRPVFTTSYENRQYGPGHNSFTQTPEGEDVLVYHARNYTEIEGDPLYDPNRHTRLKRVRW
DENGMPDFGVPPADTI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactggccaaacccgtttattgaacaacgtgccgacccatttattttacgcgac
ggcagcgattactactttattgcctccgtaccggaatatgacagactggaaatccgccgg
gctaattcgctggaagggttgcgcgccgccgaccccgttgtcgtctggcgcaaaccgaaa
acaggcccgatgagccagcttatctgggcaccggaaatgcaccgcatcaacggtaagtgg
tacatctattttgccgctacccatactcaagcgcttgataagctgggaatgttccagcac
cgcatgtttgccctggagtgcgccgatgccgacccactcaccggcaagtggacggagaaa
ggtcaaattaaaacaccgtttgataccttcgccctcgatgccaccactttttatcatcag
ggaaagcagtggtatctgtgggcgcaaaaagcgccggatattgccggtaactcaaatatt
tatctggctgaactggaaaatccgtggacgattaaaggcgagccggtaaggctcagtaag
ccagagtacgactgggagtgtcggggtttttgggttaacgaaggtccggccgtcgtggtg
catggcgacaagctgtttatcagctattcggccagcgccaccgatgaaaactactgtatg
gggttactgtggattaacgtaaacgacgatccgctcaccccgcagaactggcataaatca
ccgcgcccggtctttaccaccagctatgagaatcgccagtatgggccgggacacaacagc
tttacgcaaacgccggaaggtgaagatgtactggtgtaccacgcgagaaattacaccgaa
attgaaggcgatccgttgtacgatcccaaccgccatacgcgtctgaaacgggtgcgctgg
gacgaaaacgggatgcctgattttggcgtgccgccagccgatacgatctaa

DBGET integrated database retrieval system