KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0149Help
Entry
SSPA0149          CDS       T00756                                 

Definition
(GenBank) putative symporter
  KO
K03292  glycoside/pentoside/hexuronide:cation symporter, GPH family
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_2 MFS_1 CedA
Motif
Other DBs
NCBI-ProteinID: CAR58260
Position
complement(175080..176486)
Genome map
AA seq 468 aa AA seqDB search
MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLTPALVGVLLLSVRVIDAV
TDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWGYNNKVVYAFVTYFLLS
VTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLSLTLLPMVDWFGGGDKAK
GYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDFKDVWKNDQWVRILLLTLC
NVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIGSMLAKVLTDRWCKLKVFFW
TNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPLHWSLMADVDDYGEWKTGKRI
IGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQSASAMNGIMLLFTVIPGVGYL
ITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQELNAAESVRKA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggataagggcagactttcggtaagagagaaaatcgggtatggtatgggcgacgccgga
tgtaacattatttttggcgctatcatgctgtttgttaattacttttatacggatattttt
ggtcttaccccggcgttagtcggtgttttactcctttcagtacgcgttatcgatgccgtt
accgatccggtgatgggcgcgcttgccgatcgtacccaaagtaaatatggtcgtttccgc
ccctggctactgtggattgcatttccctacgcgctgttcagcgttctgatgttcacgacg
ccggactggggctataacaacaaagttgtctatgctttcgtcacctattttctgctttcc
gtgacctacaccgccatcaatattccctattgctcactgggcggcgtgatcactaacgat
ccaaaagagcgcgtggcctgtcaggcttatcgcttcgtgttagtcggcatcgcgacgctg
ttgctatcgttaacgctattgccgatggtggactggtttggcggcggcgacaaagccaaa
ggctatcagttggcgatgaccgtgctggcgattatcggcatgggtatgtttctgttctgc
tttgccagcgtccgcgaacgcgttcgccctgccgttccgacgcacgatgatatgaagaat
gatttcaaagatgtgtggaaaaacgatcaatgggtacgcattctgctattgaccttatgt
aacgtctgcccggggtttatccgtatggcggcgaccatgtattacgtcacctgggtgatg
ggacaaagcacccatttcgctacgctttttattagtcttggcgtggtcggtatgatgatc
ggcagtatgctggcaaaagtcttaaccgatcgctggtgtaaattgaaggtatttttctgg
accaatatcgcgctggcgattttctcctgcgcgttctatttctttgatccgaaagccacc
gtgatgatagtggcgctctacttcctgctcaatattctgcatcagatcccttccccgctg
cactggtcgctgatggcggacgtcgacgattacggcgaatggaaaaccggcaaacgcatt
atcggtatcagcttctccggtaacctgttcttcctgaaactgggcctggcgattgccggg
gcgatggtcggctttttgctctcctggtacggttatgacgccagcgccaaagcgcaaagc
gcctcggcgatgaacggtattatgctgttgtttaccgttatccccggcgttggctatctg
attaccgcaggcgtggtacgtctgctgaaagttgaccgtgaactgatgaaaaaaatccag
gacgatttggaaaaacgtcgcactaattaccgcgaattgagtgagttgcaggagctcaac
gccgctgaaagcgtaaggaaagcctga

DBGET integrated database retrieval system