KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0151Help
Entry
SSPA0151          CDS       T00756                                 

Definition
(GenBank) pyruvate dehydrogenase complex repressor
  KO
K05799  GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sek03000]
    SSPA0151
Transcription factors [BR:sek03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    SSPA0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR FCD MarR_2 MarR PaaX HTH_DeoR HTH_11 TrmB HTH_24 Fe_dep_repress HTH_28 HTH_29 Rrf2 HTH_10 HTH_41 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: CAR58262
Position
178586..179350
Genome map
AA seq 254 aa AA seqDB search
MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEA
KGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETRHALEGIAAYYAALRST
DEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHNVVLLHLLRCMEPMLAQN
VRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASHRHLAFIEEIMLDRSREES
RRERALRRLEQRKN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcctacagcaaaatccgccaaccaaaactctccgatgtgatcgagcagcagctggag
tttttaatccttgagggaacattgcgtcccggagaaaaactcccaccggaacgtgaactg
gcaaaacagttcgacgtctcccgtccctccttgcgcgaggcgattcaacgtctcgaagcg
aagggattgttgcttcgtcgccagggcggcggaaccttcgtgcagagcagcctgtggcag
agctttagcgacccgctggtggaactgctctccgatcaccctgaatcccagtttgacctg
ctcgaaacgcgccatgctctggaaggcattgcggcttattacgcggcgctgcgcagcacc
gatgaagataaagaccgtattcgcgagctgcaccatgctattgagctggcgcaagagtcc
ggcgatctggatgccgagtccgaagccgtgctccagtatcaaatcgccgtcaccgaagcg
gcgcacaacgtggtattgcttcatctgctaaggtgtatggagccgatgctggcgcaaaac
gtgcggcagaacttcgaattgctgtatgcgcgtcgggagatgctgccgctggtgagtacg
catcgcacccgtatatttgaagccattatggccggaaaaccagaagaagcgcgtgaagcg
tcacaccgacatctggcgtttatcgaagagattatgctggacagaagccgtgaggagagc
cgtcgtgaacgcgctttacgccgcctggaacagcgcaagaattag

DBGET integrated database retrieval system