KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0152Help
Entry
SSPA0152          CDS       T00756                                 

Definition
(GenBank) pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00010  Glycolysis / Gluconeogenesis
sek00020  Citrate cycle (TCA cycle)
sek00620  Pyruvate metabolism
sek01100  Metabolic pathways
sek01110  Biosynthesis of secondary metabolites
sek01120  Microbial metabolism in diverse environments
sek01130  Biosynthesis of antibiotics
sek01200  Carbon metabolism
Module
sek_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSPA0152
   00020 Citrate cycle (TCA cycle)
    SSPA0152
   00620 Pyruvate metabolism
    SSPA0152
Enzymes [BR:sek01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SSPA0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transketolase_C PFO_beta_C
Motif
Other DBs
NCBI-ProteinID: CAR58263
Position
179510..182173
Genome map
AA seq 887 aa AA seqDB search
MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEVRKGGVKVAAGAGASNY
INTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDV
CFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQMDNFRQEVHGNGLSSYPH
PKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESK
GAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEGIFAGAGWNVIKVMWGGRWD
ELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWAL
NRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGDTAEGKNIAHQVKKMNMDGVRY
VRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQALHGYLPSRQPNFTEKLELPQLS
DFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGASWLAAATSYSTNDLPMIPFYIYY
SMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPAGAEEGIRKGIYKLETL
EGSKGKVQLLGSGSILRHVREAAQILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHP
LETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEIDKKVVADAITKFNIDADKVNPRLA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgtttccaaaatgacgtggatccgatcgaaactcgcgactggctacaggcg
atcgaatcggtcatccgtgaagaaggtgttgagcgcgctcagtatctgattgaccaactg
ctttctgaagttcgtaaaggcggcgtgaaagtcgcggcaggcgcaggggccagtaattac
atcaacactattgccgttgaagacgaaccggaatacccgggcaatctggagctggaacgt
cgcattcgttctgcgatccgctggaacgccatcatgaccgtgctgcgcgcgtctaaaaaa
gaccttgagttgggcggccacatggcgtccttccagtcttccgccacgatctatgatgtc
tgtttcaaccatttcttccgtgcgcgcaacgaacaggatggcggcgacctggtgtacttc
cagggccacatctctccgggcatctacgctcgcgcgttcctggaaggtcgtctgacccag
gaacagatggataacttccgtcaggaagtgcatggcaatggcctctcttcctatccgcac
ccgaaactgatgccggaattctggcagttcccgaccgtctctatgggtctgggcccaatc
ggtgctatctaccaggcgaaattcctgaaatatctggaacaccgtggcctgaaagatacc
tctaaacagaccgtttacgccttcctcggcgacggcgagatggacgagccggaatccaaa
ggcgcgatcaccatcgccacccgtgaaaaactggacaacttggtctttgttatcaactgt
aacctgcaacgtcttgacggcccggtcaccggtaacggcaagattgttaacgaactggaa
ggcatctttgcaggtgctggctggaacgtgatcaaagtcatgtggggcggtcgttgggat
gaactgctgcgtaaagacaccagcggtaagcttatccagctgatgaacgaaaccgttgac
ggtgactaccagaccttcaaatccaaagacggcgcttacgtacgtgagcacttcttcggt
aaatatccggaaaccgccgcgctggtggctgactggactgacgagcagatttgggcgctg
aaccgcggtggtcacgatccgaagaaagtttacgcggcactgaaaaaagcgcaggaaacc
aaaggcaaagcgaccgtaatcctggcccataccattaaaggttacggcatgggtgacacc
gcggaaggtaaaaacatcgctcaccaggttaagaaaatgaacatggacggcgtgcgttac
gtccgcgatcgtttcaacgtgccggttgccgatgctgatctcgaaaaactgccgtacatt
accttcccggaaggttctgaagaacacaaatacctgcatgaacgccgtcaggcgctgcat
ggctacctgccaagccgtcagccgaacttcaccgagaagttagagctgcctcaactttca
gatttcggcgcgctgctggaagagcaaagcaaagagatttccactacgatcgctttcgtg
cgcgccctgaacgtgatgctgaagaacaagtcgatcaaagatcgcctggtaccgatcatc
gccgacgaagcgcgtactttcggtatggaaggtctgttccgtcagattggtatctacagc
ccgaacggccagcagtacaccccgcaggaccgtgagcaggttgcttactacaaagaagac
gagaaaggccagattctgcaggaagggatcaacgagctgggcgcaggcgcatcctggctg
gctgcggcgacctcttacagcaccaacgatctgccgatgatcccgttctatatctactac
tccatgttcgggttccagcgtatcggcgacctgtgctggcaggctggcgaccagcaggct
cgcggcttcctgatcggcgggacttccggtcgtactacgctgaacggcgaaggtctgcag
cacgaagatggtcacagccacattcagtcgctgactatcccgaactgtatctcttacgac
ccggcttacgcttacgaagtggctgtcatcatgcatgatggtctggagcgtatgtacggt
gagaaacaagagaacgtttactactacatcaccaccctgaacgaaaactaccacatgccg
gccatgccagcaggtgccgaggaaggtatccgtaaaggtatctacaaactcgaaaccctt
gaaggtagcaaaggtaaagttcagctgctgggctccggttctatcctgcgtcacgtgcgt
gaagcggcacagatcctggcgaaagactacggcgtaggttctgacgtgtacagcgtaacc
tccttcaccgaactggcgcgtgatggtcaggattgtgagcgctggaacatgctgcacccg
ctggaaaccccgcgcgtaccgtacatcgctcaggtgatgaacgacgctccggcagtggca
tctactgactatatgaaactgttcgccgagcaggttcgtacttacgtaccggctgacgac
tatcgcgtactgggtacggatggcttcggtcgttccgacagccgtgagaacctgcgtcac
cacttcgaagttgatgcttcttatgtggttgtcgcagcgctgggcgaactggctaaacgt
ggcgaaatcgacaagaaagtggtagcggatgcgattaccaaattcaacatcgatgcagat
aaagttaacccgcgtctggcgtaa

DBGET integrated database retrieval system