KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0155Help
Entry
SSPA0155          CDS       T00756                                 

Definition
(GenBank) probable secreted protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IL10
Motif
Other DBs
NCBI-ProteinID: CAR58266
Position
185992..186276
Genome map
AA seq 94 aa AA seqDB search
MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGEDLNAQHQQITHTHEG
VWAANSGSIQADEAALTSNKPPVQGHPELMPHQG
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttttctgacaacagcagcgctaactgcgaccttgatttccggcatggcattt
gccagcgatcccgtcatcccctgggcgactaacagcggcggtacggaaagcacgcatatt
gcggcaatgggcgaggatttgaatgcgcagcatcagcagatcacccacacgcatgaaggc
gtatgggcggccaattccggcagcattcaggctgatgaagccgcgctgaccagcaacaag
ccgccggtacaaggccacccggaattgatgccgcatcagggctaa

DBGET integrated database retrieval system