KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0169Help
Entry
SSPA0169          CDS       T00756                                 

Definition
(GenBank) hypoxanthine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00230  Purine metabolism
sek01100  Metabolic pathways
sek01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SSPA0169
Enzymes [BR:sek01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     SSPA0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: CAR58280
Structure
PDB: 

Position
203133..203669
Genome map
AA seq 178 aa AA seqDB search
MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRGSFMFMADLCREVQIPH
EVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILGLREP
KSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQRYRHLPYVGKVVLLDE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatactgttgaagtcatgatccccgaagcggagatcaaagcacgtattgccgag
ctgggtcgtcagattaccgaacgttataaagacagcggcagtgaaatggtgctggtaggt
ctgttgcgtggctcatttatgtttatggcggacctgtgccgtgaagttcagattcctcat
gaagtcgattttatgaccgcctccagttatggtagcggtatgtccaccacccgcgacgtg
aaaatcctcaaagatctggacgaggatattcgtggtaaagacgtgctgattgtcgaagac
attattgattccggtaatacgctgtcgaaggtccgtgaaatcctgggcctgcgcgagccg
aaatcgctggcgatttgtacgctgctggataaaccgtctcgtcgcgaagtggacgtgccg
gttgagttcgttggcttttcgattccggacgaatttgtagtcggttacggtatcgactac
gcccagcgttatcgccatctaccgtatgttggtaaagtggtgctgctggacgagtaa

DBGET integrated database retrieval system