KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0171Help
Entry
SSPA0171          CDS       T00756                                 

Definition
(GenBank) hypothetical ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Module
sek_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sek02000]
    SSPA0171
Transporters [BR:sek02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SSPA0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_29 DUF4162 SMC_N CelD_N AAA_27 AAA_30 SRP54 AAA_23 RNA_pol_Rpb1_1
Motif
Other DBs
NCBI-ProteinID: CAR58282
Position
204498..205424
Genome map
AA seq 308 aa AA seqDB search
MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSG
RVNVFGYDLEKDVVNAKRQLGLVPQEFNFNPFEMVQQIVVNQAGYYGVEHKEAVLRSEKY
LKQLDLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELRRSMWGFLK
DLNAKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKNLLSKLKSETFILDLAPKS
PLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLSEQGVQVLSMRNKANRLEELFVSLV
HEKQGDRA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgcgctggaacttcaacaacttaaaaaaacctatcccggcggcgttcaggcg
ctgcgcggcatagatttgcaggtcgaagcgggggatttttacgcgcttttggggccaaat
ggagcagggaaatcgaccaccatcggtattatcagctcattggttaataaaacgtccggg
cgcgttaacgtttttggttacgacctggaaaaagacgtggttaacgccaagcgacagctt
ggactggtgccacaggagtttaactttaacccgtttgaaatggtgcaacagatcgtagtg
aatcaggccggttattacggcgtggaacataaagaggcagttttacgtagcgaaaagtat
ttaaaacagctcgatctgtgggaaaaacgtaatgaacgcgcgcggatgctgtccggtggg
atgaaacgccgcctgatgatcgcccgcgcgctgatgcatgagcctaagttattgattctc
gatgagccgacggcgggcgtcgatatcgaattgcgtcgctcaatgtgggggttcctgaaa
gatttaaacgccaaaggcaccaccattattctcaccacccactatctggaagaggcagaa
atgctgtgccgcaatatcggtattattcagcacggcgagctggtggaaaatacctccatg
aaaaatctgctttcaaagctgaaatcggagacgtttattctggatttagcgccaaaaagc
ccgctacctaagcttacgggttatcaatatcgtctggtggatacctcgactctggaggtg
gaagtgttacgcgagcagggggttaacagcgtctttagccaactgagcgagcagggggtt
caggtattaagtatgcgtaataaagccaaccgtctggaagaactgtttgtgtcgctggtg
catgaaaaacaaggagatcgcgcatga

DBGET integrated database retrieval system