KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0176Help
Entry
SSPA0176          CDS       T00756                                 

Definition
(GenBank) putative fimbrial protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial FimA
Motif
Other DBs
NCBI-ProteinID: CAR58287
Position
complement(209102..209662)
Genome map
AA seq 186 aa AA seqDB search
MLLMGLTGGFWSGISQAGSNLDINLTASIVNSTCKLSLVNGGEVYLPNVTRAWFYNNDGS
SKYAPTDEAGGTPFNVRLEDCADNSSIKQLMFSFTPQSGFWSNQNQVFKNDATTGAAQNV
GIVIFSADYKTNVLNSDGSSNVVYDVSGKSSSLYLTDYQFYARYQNTGAVVSGVVTSNVL
VDVSYE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcttatgggtctgacaggcgggttttggtctggcatcagccaggcgggttccaat
ttggatatcaatctgaccgccagtattgttaacagcacctgcaaactcagtctggtaaat
gggggggaagtctaccttcccaacgtcacgcgggcatggttttacaataacgacggcagc
agtaaatatgcgcctaccgacgaggcgggcggcacgccttttaacgtgcgtctcgaagac
tgtgcagataacagtagcatcaagcagttgatgttcagctttacgccgcaatccggtttt
tggagcaaccaaaaccaggttttcaaaaatgatgccacaacaggcgcggcgcaaaacgtt
ggtatcgtcattttctcggcagactataaaactaacgtcttaaacagcgatggcagttct
aacgtagtttacgacgtcagcggaaaaagcagttcgctgtatttaacggattatcagttt
tacgcgcgctatcagaatacgggcgcagttgtcagcggcgttgtcaccagcaacgtgttg
gttgacgtcagctacgaataa

DBGET integrated database retrieval system