KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0178Help
Entry
SSPA0178          CDS       T00756                                 

Definition
(GenBank) putative fimbrial protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial
Motif
Other DBs
NCBI-ProteinID: CAR58289
Position
complement(210304..210876)
Genome map
AA seq 190 aa AA seqDB search
MKRNRLSLPIAALAVMAASGSALAANSTNLDVNFTATILETTCNMKLVGGTGSDTVQELI
IGNSSGEVRIDDVRAGTATADFKLVIVECPASLQSLKTSINGTPSGYSTKILTNGTKGSA
DYIGVSVARASKPDEPFVINSTADSERLVWSEVEINSKEVPLIAIMKETKANSATTGAFS
AVATFVFSYE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaccgcctcagtcttcccatcgcggcacttgccgtaatggcagcttctgga
agcgcgcttgccgctaactccactaacctggatgttaatttcacggccacaattttagag
acgacgtgtaacatgaaactggtcggtggtacaggctccgacacggtacaggaattaatc
attggtaatagtagtggtgaagttcgtattgatgatgtaagagcgggaacagcaacggca
gattttaaattagtgattgttgaatgcccggcatcgcttcaatcattaaagacatcaatc
aacggaacgccatccgggtattcaacaaaaatattaacgaatggaacaaaaggctcagcc
gactatataggggtgtcagtagcgcgcgcatccaaaccagatgaaccttttgttattaac
tccaccgccgattcagaacgtctggtctggagtgaggtagaaattaacagtaaagaggtt
ccgctgatcgccatcatgaaagagaccaaggcaaattcggctaccacaggggctttctca
gccgttgcgactttcgtatttagctacgagtaa

DBGET integrated database retrieval system