KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0179Help
Entry
SSPA0179          CDS       T00756                                 

Definition
(GenBank) outer membrane usher protein
  KO
K07347  outer membrane usher protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sek02000]
    SSPA0179
   02044 Secretion system [BR:sek02044]
    SSPA0179
   02035 Bacterial motility proteins [BR:sek02035]
    SSPA0179
Transporters [BR:sek02000]
 Other Transporters
  Pores ion channels [TC:1]
   SSPA0179
Secretion system [BR:sek02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   SSPA0179
Bacterial motility proteins [BR:sek02035]
 Pilus system
  Fimbrial proteins
   SSPA0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usher PapC_N PapC_C
Motif
Other DBs
NCBI-ProteinID: CAR58290
Position
complement(210911..213508)
Genome map
AA seq 865 aa AA seqDB search
MLFQRSLLCLTIGAALPFSVSAANSAAEKTVVESDEAVEFNEQFLLNSSANIDISRYAYG
NPVLAGTYRVKVNLNNALKSTSEITFNENGTPRASACLTPLLLTQAGVDPAAMRDDVEVD
DNTTCLDIKKYYPGATANYDSGKQAMDLNFPQIYILKRPAGYVDPSLWEDGVPAAIVSYD
MNAWHSEGNGTTSDTAYVELRYGLNMGPWRLRSRGSLNWNKDTGSEYNNQDVYLQRDITA
LKAQMVIGDSYTRGDAFDSFSLSGIRMYNDDRMLPMGSSNYAPVIRGVANSNAKVTVMQS
GNKIYETTVPPGAFEINDLSTTGYGNDLLVTVEEADGSKRSFTVPFSSVTQMLRPGATRW
DIGVGELNDDSLHDKPQVGYAQFYYGLNNTFTGYIGAQYTDMNFYAGLLGLAMNTGIGAF
AFDVTQSHASIDDLGTLSGQNYRLTYSKMIEATNTSFNVAAYRFSTEDYLSLNDAASLQD
SVKHQQYAQQSYRSGDELYDDYQRTKNQVQISINQPLNQGETTWGSVYVSGTWQDYWNDA
GSTANYSVGYNNSFAYGSYSVSLQRAYDQNGSKDDSVYLSFSIPLSMFSHNGERSGGFSN
INMGLRSDMKGGTNVNSTASGNTKDSDISYSVSATSSSGNYGNLNQVSGFGSLNSSYGPL
GLSASFGDDNSQQYSASYSGGMVLHSGGVAFTPGSIGETDAVALVKASGAQGAGLGYSSS
EIGSSGYGILPYMSAYRENRVSLDISTLENDVEIKSTSTVTVPRSGAVVLVNFETDEGRS
LILELLRSDKGFIPLGADVLNEKNETVGTVGQAGQAYVRGVEPQGELRVVWGSGKESTCT
VRYQLAETTAKAGLTPVLSNQLCHL
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgctatttcaacgctcattattatgtcttactattggcgctgcactccctttttccgtt
tctgctgcaaattcagcagcagaaaaaaccgttgttgagtcggacgaagccgtagaattt
aacgagcaatttttacttaatagcagcgctaatatcgatattagtcgctatgcgtatggc
aacccggtgcttgccggaacctatcgtgtgaaagtgaatcttaacaatgcgttgaaatct
acctctgaaattacctttaatgaaaacggtacgccacgcgccagtgcatgtctgacgccg
cttttactcacccaggcaggtgttgatcccgccgcaatgcgcgatgacgtcgaggtcgac
gacaacaccacgtgtctggatataaaaaaatactaccccggtgcgacggcgaattacgat
tccggcaaacaggcgatggatctcaacttcccgcagatttatatcctgaaacgtcctgcc
gggtatgttgacccctcactgtgggaagatggcgttccggcggccatcgtctcttatgat
atgaacgcctggcacagtgaaggcaatggcacaacgtccgataccgcttacgtggagcta
cgttacggtttaaatatgggaccgtggcgtttgcgttcccgaggtagccttaactggaac
aaagataccggtagcgaatacaacaatcaggacgtttatttacagcgagatatcaccgcg
ctgaaagcgcaaatggtgataggcgactcctacacccgtggcgatgcgtttgactccttc
agcctgagcgggatacggatgtataacgatgaccgcatgttaccgatgggctccagcaac
tacgcgcctgttatccgcggcgtcgccaacagcaatgccaaagtcacggtgatgcaaagc
ggcaataaaatctacgaaaccaccgtaccgccgggggcgttcgagattaacgaccttagc
accacaggttatggtaacgatctgctggtcaccgtagaagaagcggacggcagcaaacgc
agctttaccgttcccttttcgtcagtcacccaaatgttacgccccggcgcgacacgctgg
gatatcggcgtcggcgagctgaacgatgattctttacatgataaaccgcaggtgggttac
gcgcagttttactatggcctgaacaacacctttaccggctatatcggcgcgcagtatacc
gatatgaatttctatgctgggttattaggtctggcaatgaacaccggtattggcgcattc
gcctttgatgtgacgcaatctcacgccagtattgatgatttaggcacgctcagcgggcaa
aactaccggctgacctatagcaaaatgatcgaggcgaccaatacctcatttaacgtcgct
gcttatcgtttttctactgaagactacctcagcctgaatgacgccgcgtctttgcaagac
agcgttaaacatcagcaatatgcgcagcaaagttatcgctcaggtgatgagttatatgac
gattaccagcgtaccaaaaatcaggtgcaaatcagcatcaaccagcccttaaaccaggga
gaaacaacctggggctctgtgtatgtcagcggaacatggcaggactactggaatgatgcg
ggctccacggccaactatagcgtgggttacaacaacagttttgcctacggcagctatagc
gtgtcattacaacgcgcctatgaccagaacggcagtaaagacgatagcgtctatttaagt
ttcagtattccgttgagtatgttctcccacaacggggaacgctctggcggtttctccaat
atcaacatgggcctgcgttctgacatgaagggcggtactaacgtcaactccaccgccagc
ggtaataccaaagatagcgacatcagctactccgtgagcgccacctccagcagcggtaat
tacggcaacctgaatcaggtaagtggctttggctcccttaacagcagctatggcccatta
gggctttccgcctcgtttggcgacgacaatagccagcaatattccgccagttacagcggt
ggcatggtgctgcattctggcggcgtagcgttcacgccgggcagcattggcgaaaccgac
gccgtcgcactggtgaaagccagcggcgcacaaggcgcaggactgggctacagcagcagc
gaaatcggcagctcaggctatggcattttaccgtatatgtcagcctaccgcgaaaaccgg
gtgtcgctggatatcagcacactggagaacgatgttgaaatcaaaagcaccagcacggtt
accgtaccgcgcagcggcgccgttgtgctggtgaattttgaaaccgatgaaggtcgctca
ctgattctggaattactgcgtagcgataaaggctttattcctttaggcgcagatgtcctt
aacgagaaaaatgaaactgtcggtaccgtaggccaggccggacaggcgtacgtgcgcggc
gtagaaccgcaaggcgaacttcgcgtggtgtggggcagtggtaaagaaagcacctgtacg
gtgcgttaccaattagctgaaaccacggcaaaagcgggactaacccccgtattgagcaat
caactttgtcacctgtaa

DBGET integrated database retrieval system