KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0181Help
Entry
SSPA0181          CDS       T00756                                 

Definition
(GenBank) major fimbrial subunit
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial FimA
Motif
Other DBs
NCBI-ProteinID: CAR58292
Position
complement(214415..215020)
Genome map
AA seq 201 aa AA seqDB search
MFFRKYGVAAFIAMTLSAGSAMAADPDTGTITFHGLVSNNTCKISLDNKIDQDGNDFDIT
LDTVFVKNFATALGDNSTLGEKQFTLNLSECDNATVKDASAQFNSWGGSSSTSGGLLVPP
ANLQGAAENVNLVLANNGNGATDLIKIDQTNNTQKATISADGTGDLFYRVAYTQGQKWNA
DTSPVTAGTVQAQVAFTVIYN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcagaaaatatggcgtagccgcttttattgcaatgactttgagtgccgggtct
gcaatggcagcagatccagatacgggtactattactttccacggtctggtttctaacaat
acctgtaaaatctctcttgataataaaatagatcaagacggtaatgattttgacattacg
ctggataccgtttttgttaaaaacttcgctaccgcactgggtgataatagtactctgggc
gaaaaacagttcactctgaatctgagcgaatgtgataacgcaacggtaaaagatgcctcc
gcgcaatttaattcctggggcggttccagctcaacgtcaggtggtctgttagtaccaccg
gctaatctgcaaggagcagcagaaaacgttaacctggtgctggctaacaacggtaacggc
gctaccgatctgatcaaaattgaccagactaacaacacgcagaaagccactatttccgct
gatggcactggtgacctgttctaccgcgtagcctacacccaaggccagaagtggaatgca
gacaccagcccggtaacggcaggaaccgtacaggcacaagttgccttcaccgttatttat
aactaa

DBGET integrated database retrieval system