KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0188Help
Entry
SSPA0188          CDS       T00756                                 

Definition
(GenBank) dosage-dependent dnaK suppressor protein
  KO
K06204  DnaK suppressor protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sek03000]
    SSPA0188
   03021 Transcription machinery [BR:sek03021]
    SSPA0188
   03009 Ribosome biogenesis [BR:sek03009]
    SSPA0188
Transcription factors [BR:sek03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SSPA0188
Transcription machinery [BR:sek03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     SSPA0188
Ribosome biogenesis [BR:sek03009]
 Prokaryotic Type
  rRNA transcription factors
   SSPA0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-dskA_traR DZR
Motif
Other DBs
NCBI-ProteinID: CAR58299
Position
complement(220664..221119)
Genome map
AA seq 151 aa AA seqDB search
MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILEAWRNQLRDEVDRTVT
HMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVE
IGIRRLEARPTADLCIDCKTLAEIREKQMAG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagggcaaaaccgtaaaacatcgtccctgagtattctcgccatcgctggggtg
gagccgtaccaggagaaaccgggcgaagagtatatgaacgaagcccagctatcgcacttc
aagcgtattcttgaagcatggcgtaatcaactccgggatgaagtcgatcgcactgtgacg
cacatgcaggacgaagccgccaacttccccgatccggtcgatcgcgccgcgcaggaagag
gagtttagcctggagttacgtaatcgtgaccgtgagcgcaaactgatcaaaaagatcgag
aagacgctgaagaaagtggaagatgaagacttcggttattgcgagtcctgcggggtggag
attggtatccgccgcctggaagcgcgtccaacagccgatctgtgcatcgactgcaaaacg
ctggctgaaattcgcgaaaaacagatggcgggttaa

DBGET integrated database retrieval system