KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0189Help
Entry
SSPA0189          CDS       T00756                                 

Definition
(GenBank) sugar fermentation stimulation protein
  KO
K06206  sugar fermentation stimulation protein A
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    SSPA0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SfsA SfsA_N Chordopox_A20R
Motif
Other DBs
NCBI-ProteinID: CAR58300
UniProt: B5BL70
Position
complement(221296..222000)
Genome map
AA seq 234 aa AA seqDB search
MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGCATPGDTVWYSTSENTK
RKYPHTWELTETQFGAFICVNTLRANQLTKEAIQENRLPALAGYNILKSEVKYGAERSRI
DFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKHLRELMGVAAAGHRAVVVFAV
LHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQKMELNEPVPITL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgctattctcaccccctttacaacgcgctacgttgattcagcgctataaacgtttttta
gctgatgtcatcacccctgacggtacgacgcttacgctgcactgtcctaatactggcgcg
atgaccggctgcgccacgcctggcgataccgtctggtattcgacatcagaaaatactaaa
cgcaaatatccgcatacctgggaattgactgaaacgcaattcggcgcattcatttgcgtg
aatacgctgcgggcgaaccagctaacgaaagaagcaattcaggagaatcgcctgccggcg
ctggcggggtacaatattctgaaaagtgaagtcaaatatggcgccgaacgcagccgtata
gattttatgttacaggcagatttccgcccggactgctatattgaagtgaaatcggtcacg
ttagcggaaaaagaaaacggttattttcccgacgccatcaccgaacgagggcaaaaacat
cttcgggagttgatgggcgttgcggcggcaggtcatcgcgcggtggtggtgttcgcggtg
ctgcactccgccattacacgtttttcccccgcacgtcatatcgatataaaatacgcgcag
ctattgagcgaggctcagaataaaggcgtggaagttttagcttataaagcagaactttca
gcccaaaaaatggaactgaacgaaccagtacccataacgttgtag

DBGET integrated database retrieval system