KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0193Help
Entry
SSPA0193          CDS       T00756                                 

Definition
(GenBank) ferrichrome transport ATP-binding protein FhuC
  KO
K02013  iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek02010  ABC transporters
Module
sek_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSPA0193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sek02000]
    SSPA0193
Enzymes [BR:sek01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     SSPA0193
Transporters [BR:sek02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    SSPA0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_15 AAA_23 AAA_22 AAA_16 AAA_33 RsgA_GTPase AAA_18
Motif
Other DBs
NCBI-ProteinID: CAR58305
Position
230281..231078
Genome map
AA seq 265 aa AA seqDB search
MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGHNGSGKSTLLKMLGRH
QPPSEGDILLDNQPLASWSGKAFARKVAYLPQQLPQAEGMTVRELVAIGRYPWHGALGRF
GVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDI
AHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALRGGEMIAQGTPAELMRSDT
LEQIYGIPMGILPHPAGAAPVSFVY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaaccacattcattccgataccacctttgcgctgcgaagcgtcgcctttcgt
gtgccgggccgcacgcttttacaccccctctcgttaacgtttcccgcaggtcgcgtcacc
ggacttatcggccataatggttccggtaaatccacgctgttaaaaatgctgggccgccat
cagccgccttccgaaggggatattctgctcgacaatcagccgctggcgagctggagcggc
aaggcgtttgcccgcaaagttgcctatctgcctcaacaattgccgcaagcggaaggaatg
acggtgcgcgaactggtggcgattggccgctatccgtggcacggcgcgctgggacgcttt
ggcgtcgcggaccgggaaaaagtagacgaggcgattacgctggtcggcttaaaaccgctg
gcgcatcgtctggtcgatagcctgtccggcggtgaacgccagcgagcgtggattgccatg
ctggtcgcgcaggacagccgttgtctgctgctggatgagccgacgtcagcgctggatatc
gcccatcaggttgacgtgctggcgctggtgcatcgtttaagccaacagcgcgggctgacg
gtggttgcggtgctgcacgatatcaacatggcggcccgctactgtgattatttagtcgcg
ctacgcggcggtgaaatgattgcgcaaggaacgcctgcggaactgatgcgcagtgacacg
ctggaacagatttacggtatcccgatgggtatccttccgcatccggcgggcgccgcacct
gtgagttttgtgtattaa

DBGET integrated database retrieval system