KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0195Help
Entry
SSPA0195          CDS       T00756                                 

Definition
(GenBank) ferrichrome transport protein FhuB precursor
  KO
K02015  iron complex transport system permease protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek02010  ABC transporters
Module
sek_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSPA0195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sek02000]
    SSPA0195
Transporters [BR:sek02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    SSPA0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: CAR58307
Position
231965..234022
Genome map
AA seq 685 aa AA seqDB search
MSRKREMPDGGAKNALTDLRFGRFVGRIRRSRHPALLLLALLVAACWLTWVNFSVALPRS
QWQQAIWSPDIDIIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGV
ATGAQLGITVTTLWAIPGALTTQFAALTGACIVGALVFGVAWGKRLSPVTLILAGLVVSL
YCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQLLGGVMLTLLLLRPMTLM
GLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGFIGLFAPLLAKMLGARRLLA
RLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLKSMSAPDMN
ASDRVAAERRHVLAFAVAGGALLLLATWVALSFGRDAHGWTWASGTLLEELMPWRWPRIL
AALMAGVMLSVAGCIIQRLTGNPMASPEVLGISSGAAFSVVLMLFLVPGNAFGWLLPAGS
LGAAATLLIIMIAAGRGGFSPQRMLLAGMALSTAFTMLLMMLQASGDPRMADVLTWISGS
TYNATGGQVTRTAIVMVILLAIVPLCRRWLTILPLGGDAARAVGMALTPSRIALLALAAC
LTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHMVISALAGGVLLVFADWCGRMALFPY
QIPAGLLSSFIGAPYFIYLLRKQSR
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaaaacgtgaaatgccggatggcggcgcgaaaaacgccttaaccgacctacgg
ttcgggcgctttgtaggccggataaggcgaagccgccatccggcgttgctgttattggcg
ctgttggttgccgcctgctggctgacatgggttaacttctccgttgcgctaccgcgcagt
cagtggcaacaggctatctggtcaccggatatcgacatcattgagcagatgatttttcat
tacagcctgctgccaagactggcgatttcgctgctggtgggcgcggggcttgggctggta
ggcgtcctgttccagcaagtattacgtaacccgctggcggaaccgaccacgctgggcgtg
gcgaccggcgcgcaattggggatcacggtgactacgctttgggcgattcccggcgcgctg
accacgcagtttgccgccctgacgggagcctgcatcgtcggcgcgctggtgttcggcgtg
gcgtggggcaaacgtctgtcgccagtgaccctgatcctcgccgggctggtggtcagcctc
tattgtggcgcaatcaaccagttactggtgattttccaccacgatcagttgcaaagcatg
tttttatggagcactggaacgctaacgcaaaccgactggagcggcgtgcagcgtctgtgg
ccgcagttgctgggcggcgtgatgctcacgttattgttgttacgcccgatgacgctgatg
gggctggatgacggcgttgcgcgtaatctgggtctggcgctgtcgttagcgcgtctggcg
gcgttgtcgctggcgattgtgttgagcgcgctgctggtcaacgcggtgggcattatcggt
tttatcggcctgtttgcgccgctgctggcgaaaatgcttggcgcaagacgtctgctggcg
cgcctgatgctggcgccgctcattggggcgcttattttatggctatccgatcagattatc
ctttggctaacccgcgtatggatggaagtctccaccgggtcagtgacggcgttaatcggc
gcgccgctgctcctgtggctgctgccgcggcttaaaagcatgagcgcgccggatatgaac
gccagcgatcgtgtggcggcggagcgtcggcatgtcctcgcttttgccgttgccggtggc
gcgctcctgctgctggcaacatgggtcgcgctctcttttggtcgcgacgcgcacggctgg
acgtgggcgagcggaacgctgcttgaagaactgatgccgtggcgctggccgcggatactg
gcggcgttaatggcgggcgtcatgctgtcggtggcgggctgcattattcagcgtctgacc
ggtaacccaatggccagcccggaagtgctggggatcagttccggagccgcgtttagcgtg
gtgttgatgctgtttttggtgccggggaatgctttcggttggctactgcctgccggaagc
ctgggcgcggcggcgacactgctgattattatgatagccgccgggcgcggcggtttctcg
ccgcaacggatgttgctggcggggatggcgctcagcactgcgtttaccatgctgctaatg
atgctccaggcgagcggcgatccgcggatggcggatgtgttgacctggatctcaggatct
acctataacgccactggcgggcaggttacgcgaaccgcgatcgtaatggtgattttgctg
gccattgtgccgttgtgtcgccgctggttaacgattttgccactgggcggcgatgccgcg
cgcgcggtgggcatggcgcttacgccgtcgcgtatcgcgctgctggcgctggcagcgtgt
ttgacggcaaccgcgacgatgaccattgggccgctgagtttcgttggactgatggcgccg
catattgcgcggatgctcggttttcgccggacgatgccgcatatggtcatctcggcgctg
gcagggggcgttttactggtctttgccgactggtgcggcaggatggcgctatttccgtat
cagatcccggcgggactgctttcaagctttattggcgcgccgtactttatctatttgcta
cgtaaacagagccggtaa

DBGET integrated database retrieval system