KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0196Help
Entry
SSPA0196          CDS       T00756                                 

Gene name
stfA
Definition
(GenBank) putative fimbrial subunit
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial DUF3950
Motif
Other DBs
NCBI-ProteinID: CAR58308
Position
234963..235523
Genome map
AA seq 186 aa AA seqDB search
MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIVVGDEHQTVNLGHIGT
GSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANPGSVALMRIGGGEMAGS
SIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKGDSAATTIDTGEFSSTVN
FTISYL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagcagtaaaagctgcggttgctgccgcactggttatgggtgtttccagcttt
gccaatgctgcaggcagtaatactggtacggtgacttttaccggtactattgaagattca
ccgtgttcaatcgtggttggcgacgaacaccagaccgttaacctgggccatatcggtacc
ggttctctgatgggcggtaaagaatcttcaaaagtcgatttccatatcggtctggaaaac
tgcgcattcaccactgagaaagaagcgtctaccgttttctctgccatcggtaacgaatcc
agcgctaatccgggcagcgttgcgctgatgcgtatcggcggcggcgaaatggcgggttcc
agcattgtcatcggcaaccacctgggttccgcgatcaaattgggcgacgcttacagcgaa
aatctgacgatgaacggcagcgttgcggcggcgaaacagactcttaacttcaaagcctgg
gtgaaaggcgattctgctgccaccactatcgataccggcgaattcagcagcaccgtaaac
ttcacgatcagctatctgtaa

DBGET integrated database retrieval system