KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0208Help
Entry
SSPA0208          CDS       T00756                                 

Definition
(GenBank) protease DO precursor; heat shock protein HtrA
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek01503  Cationic antimicrobial peptide (CAMP) resistance
sek02020  Two-component system
Module
sek_M00728  Cationic antimicrobial peptide (CAMP) resistance, envelope protein folding and degrading factors DegP and DsbA
Brite
KEGG Orthology (KO) [BR:sek00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SSPA0208
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SSPA0208
Enzymes [BR:sek01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     SSPA0208
Peptidases [BR:sek01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   SSPA0208
Chaperones and folding catalysts [BR:sek03110]
 Other chaperones and cochaperones
  DegP / HtrA
   SSPA0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ PDZ_2 Trypsin Tricorn_PDZ PDZ_1 GRASP55_65 Peptidase_S46
Motif
Other DBs
NCBI-ProteinID: CAR58322
Position
248804..250231
Genome map
AA seq 475 aa AA seqDB search
MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPMLEKVMPSVVSINVEG
STTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGNGGQQQKFMALGSGVII
DAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDIALIQIQNPKNLTAIKLA
DSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGA
LVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELN
SELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPV
GSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIEGAEMSNKGQDKGVVVSSVKAN
SPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSVLALNIQRGDSSIYLLMQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccacattagcaatgagtgcactggctctgagtttaggtttggcattgtcg
cctctgtctgccacggcggctgaaacgtcctcttcagcaatgactgcccagcagatgcca
agtctggcaccgatgctcgaaaaagtgatgccatcggtggtcagtattaatgtagaaggt
agcaccacggtgaatacgccgcgtatgccgcgtaatttccagcagttctttggcgatgac
tccccgttctgccaggacggttctccgttccagaattctccgttctgccagggcggcggt
aacggcggcaacggcggtcaacaacagaaattcatggcgctgggctccggcgtaattatt
gacgccgcgaagggctacgtcgtcaccaacaaccacgtggttgataacgccagcgtgatt
aaagtacagcttagcgatgggcgtaaattcgatgctaaagtagtgggcaaagatccgcgt
tctgatatcgcgctgattcaaattcagaatccgaagaacctgacggcgattaagctggcg
gactccgacgcgctgcgcgtgggggattataccgtcgctattggtaacccgtttggtctg
ggcgaaacggtgacgtcaggtatcgtttcggcgctggggcgtagcggcctgaacgtagaa
aattacgagaactttattcagaccgacgccgcgattaaccgtggtaactccggcggcgcg
ctggtgaacctgaacggtgagctgatcggtattaacaccgcgattctggcgccggacggc
ggtaacatcggtatcggcttcgctatccccagtaacatggtgaaaaacctgacgtcgcag
atggtggaatacggccaggtgaaacgcggcgaactggggatcatggggactgagctgaat
tccgaattggcgaaagcgatgaaagtcgatgcccagcgtggcgcgttcgtcagccaggtg
atgccgaattcgtccgcggcgaaagcgggtatcaaagccggggatgtcattacctcgctg
aacggtaaaccgatcagcagctttgcggcgctgcgcgctcaggtcggcactatgccggtc
ggcagcaaaatcagcctcggtctgctgcgtgaaggtaaagcgattacggttaatctggaa
ttgcagcagagcagccagagtcaggttgattccagcaccatcttcagcgggattgaaggc
gctgaaatgagcaataaaggccaggataaaggcgttgtggtgagcagcgtgaaagcgaac
tcacccgccgcgcaaattggcctcaaaaaaggcgatgtcattatcggcgctaaccagcag
ccggtgaaaaatatcgccgagctgcgtaagattctcgacagcaaaccgtcggtgctggcg
ctgaatattcagcgtggtgatagttctatttatttgctgatgcagtaa

DBGET integrated database retrieval system