KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0209Help
Entry
SSPA0209          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02647  carbohydrate diacid regulator
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sek03000]
    SSPA0209
Transcription factors [BR:sek03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SSPA0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GAF_2 GAF
Motif
Other DBs
NCBI-ProteinID: CAR58323
Position
250384..251541
Genome map
AA seq 385 aa AA seqDB search
MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGVLLVLSQGRV
VDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKYGELVCMTAEMMLEQSR
LMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQPRVAAVVEVDSGQLGVDS
AMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNPFGRWDAEDHRKRVEQLISRMKE
NGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPESRSYFYQDLMLPVLLDSLRG
GWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLATSKALFIHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVALQLDEQR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctggctggcatcttgataccaaaatggcgcaggatatcgtggcgcgcactatgcgc
atcatcgataccaatatcaacgtaatggatgcccgcgggcgtattatcggcagcggcgat
cgggaacgtattggtgaattgcacgaaggcgtgctgttagtgctgtcgcagggccgggtt
gtggatatcgacgacgccgtggcgcgacacctgcacggggtgcgtcaggggattaatctt
cccttacgccttgagggcgaaattgtcggcgtgatcggcctcaccggcgaaccagagcat
ctgcgtaaatatggcgaactggtgtgtatgactgccgagatgatgctggaacagtcgcgg
ttaatgcaccttttggcgcaggatagccgtttgcgcgaagagctggtgatgaacctgatt
caggccgaagaaaatacgccggcgctggtggaatgggcgcagcgtttggggatcgatttg
aaccagccgcgtgtggcggcggtggtggaagtcgacagcggccagcttggcgtcgatagc
gcaatggcggaacttcagcagttgcagaatgcgcttaccacgccggagcgtaacaacctg
atagccattgtttctctcaccgagatggtggtactcaaacccgccttaaacccgtttggt
cgttgggatgctgaagatcatcgtaagcgcgtagagcagcttatctcgcgcatgaaagag
aatggtcagctacgttttcgcgtggcgctgggcaattactttaccgggccgggcagtatt
gcacgctcataccgcacggcgcgcaccacgatgatggtcggcaaacagcggatgccagaa
agccgcagctatttttatcaggatttgatgctgccggttctgttagatagcctgcgtggc
ggctggcaggccaatgagctggcgcgcccgctggtaaaactcaaagcgatggataacaac
gggttattacgtcggacgctgacggcgtggtttcgccataatgtccagccgctggcgacc
tctaaggcgctgtttattcatcgtaacacgctggaatatcggctaaatcgtatttcggaa
ctgaccgggctggatttgggaaattttgacgatcggctgttgctgtatgtggcgctacaa
ttggatgaacagcgttaa

DBGET integrated database retrieval system