KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0210Help
Entry
SSPA0210          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3461
Motif
Other DBs
NCBI-ProteinID: CAR58324
UniProt: B5BL91
Position
complement(251630..252016)
Genome map
AA seq 128 aa AA seqDB search
MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKSVKFKYPRQRKTVVAD
GIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDLRHLESVVANKISEIEA
DLDKLTRK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacaatctaaaaagtctgggcattaccaatcctgaggaaatcgatcgttacagc
ctgcggcaagaagccaataacgatatcctgaaaatctattttcaaaaggatagaggtgaa
ttctttgctaaaagcgtgaagtttaagtatccacgccagcgtaaaacagtggtggccgat
ggcatcggtcagggttataaagaagtacaggagattagccccaacctacgctatgtgatt
gacgagctggaccaaatctgccagcgcgaccgctcagaactcgatctcaaacgtaagatc
ctcgacgacttgcgccatctggaaagcgtcgtcgcgaataagatcagtgaaatcgaagcc
gatctggacaagcttacccgtaagtaa

DBGET integrated database retrieval system