KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0215Help
Entry
SSPA0215          CDS       T00756                                 

Definition
(GenBank) 30S ribosomal protein S2
  KO
K02967  small subunit ribosomal protein S2
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek03010  Ribosome
Module
sek_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sek00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SSPA0215
Ribosome [BR:sek03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    SSPA0215
  Bacteria
    SSPA0215
  Archaea
    SSPA0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S2
Motif
Other DBs
NCBI-ProteinID: CAR58329
UniProt: B5BAM6
Position
258485..259210
Genome map
AA seq 241 aa AA seqDB search
MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKI
SARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQ
SQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLG
IPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVREGRSQDLASQAEESFVEA
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtttccatgcgcgacatgctcaaggctggtgttcactttggtcaccagacc
cgttactggaacccgaaaatgaagcctttcatcttcggcgcgcgtaacaaagttcacatc
atcaaccttgagaaaactgtaccgatgttcaacgaagctctggctgaactgaacaagatc
tctgctcgtaaaggtaaaatccttttcgttggtactaaacgcgctgcaagcgaagcggtg
aaagaagctgctaacagctgcgaccagttcttcgtgaaccatcgctggctgggcggtatg
ctgactaactggaaaacagttcgtcagtccatcaaacgtctgaaagacctggaaactcag
tctcaggacggtactttcgaaaagctgaccaagaaagaagcgctgatgcgtactcgtgag
cttgagaaactggaaaacagcctgggcggtatcaaagacatgggcggtctgccggacgct
ctgttcgttatcgatgctgaccacgagcacattgctatcaaagaagcgaacaacctgggt
atcccggtatttgctatcgttgataccaactctgatccggacggcgttgacttcgttatc
ccgggtaacgatgacgcaatccgtgctgttagcctgtacctgggcgctgtcgctgcaacc
gttcgtgaaggccgttctcaggatctggcttcccaggcggaagaaagcttcgtagaagcc
gagtaa

DBGET integrated database retrieval system