KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0217Help
Entry
SSPA0217          CDS       T00756                                 

Definition
(GenBank) uridine 5'-monophosphate kinase
  KO
K09903  uridylate kinase [EC:2.7.4.22]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00240  Pyrimidine metabolism
sek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSPA0217
Enzymes [BR:sek01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     SSPA0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: CAR58331
Position
260464..261189
Genome map
AA seq 241 aa AA seqDB search
MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNL
FRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWA
EAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLKATKVDGVFTADPAKDPS
ATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaatgcaaaacccgtctataaacgcattctgcttaaattaagcggcgaagct
ctgcagggtacggaaggcttcggtattgatgcaagcatactggatcgtatggctcaggaa
atcaaagaactggttgaactgggtattcaggttggtgtggtgattggcggtggtaacctg
ttccgtggcgcgggtctggcaaaagcggggatgaaccgcgttgtgggcgaccacatgggc
atgttggccaccgtcatgaacggcctggcaatgcgtgatgcgcttcaccgcgcctatgtg
aacgcccgcctgatgtcggcaattcctttaaacggcgtgtgcgacaactacagttgggcc
gaggcgattagcctgctgcgtaataaccgtgttgtgattctgtctgcaggtacgggtaac
ccgttcttcactaccgactctgcggcctgtctgcgcgggatcgaaattgaagcggatgtc
gtactgaaagcgaccaaagtggatggcgtattcactgccgatccggcaaaagatccttcc
gcgaccatgtacgatcagctgacctacagcgaagtgctggataaagagctgaaagtgatg
gatctggcggcgttcacgctggctcgtgaccacaaactgccgattcgtgttttcaacatg
aacaaaccgggcgcgctgcgtcgtgtggtgatgggcgaaaaagaagggacgttaatcacg
gaataa

DBGET integrated database retrieval system