KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0218Help
Entry
SSPA0218          CDS       T00756                                 

Definition
(GenBank) ribosome recycling factor
  KO
K02838  ribosome recycling factor
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sek03012]
    SSPA0218
Translation factors [BR:sek03012]
 Eukaryotic Type
  Release factors
   SSPA0218
 Prokaryotic Type
   SSPA0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRF TPP1 DUF842
Motif
Other DBs
NCBI-ProteinID: CAR58332
UniProt: B5BAM9
Position
261336..261893
Genome map
AA seq 185 aa AA seqDB search
MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTLTPLRQLASVTVE
DSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDICVPLPPLTEERRKDLTKIVRGE
AEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEVQKMTDAAIKKVDAALADKEA
ELMQF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgattagcgatatcagaaaagatgctgaagtacgcatggaaaaatgcgttgaagcgttc
aaaacccaaatcagcaaagtgcgcacgggtcgtgcttctcccagcctgctggatggtatt
gtcgtagaatactatggcactctgaccccgctgcgccagttggcaagcgtaacggtagaa
gactcccgtaccttaaaaattaacgtgtttgaccgttctatggggccagccgttgaaaaa
gcgatcatggcgtcagacctcggtttgaatccaagctctgcgggcaccgacatttgcgtt
ccgctgccgccgctgaccgaagaacgtcgtaaagatctgacgaaaattgtccgtggcgaa
gcggagcaggcgcgtgtcgccgttcgtaacgtccgccgtgatgcgaacgataaagtaaaa
gctctgctgaaagataaagcgatcagtgaagatgacgatcgtcgctctcaggaagaagta
cagaaaatgaccgacgcggcaattaagaaagttgatgcggcgttggcagataaagaagca
gaactgatgcagttctga

DBGET integrated database retrieval system