KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0222Help
Entry
SSPA0222          CDS       T00756                                 

Definition
(GenBank) putative membrane protein
  KO
K11749  regulator of sigma E protease [EC:3.4.24.-]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sek00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SSPA0222
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sek01002]
    SSPA0222
Enzymes [BR:sek01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     SSPA0222
Peptidases [BR:sek01002]
 Metallo Peptidases
  Family M50: S2P protease family
   SSPA0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M50 PDZ_6 PDZ PDZ_2 Tricorn_PDZ
Motif
Other DBs
NCBI-ProteinID: CAR58336
Position
265184..266536
Genome map
AA seq 450 aa AA seqDB search
MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYV
IALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAGPVANFIFAIFAYWLVF
IIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWDAVRLQLVSKIGDQQTTV
SVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQIEPVLSEVQANSAASKAGL
QAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGSALSLTLTPDTKSVNGKAEG
FAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG
PISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLPVLDGGHLLFLAIEKLKGGPVS
ERVQDFSYRIGSILLVLLMGLALFNDFSRL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtattctctggaatctggctgcattcatcatcgcactgggcgtgctgatcact
gtgcatgaatttggtcatttctgggttgcccggcgctgcggtgtgcgagttgagcgcttt
tccatcggttttggcaaagcgctctggcgtcgtaccgatcggtacggcaccgagtatgtc
atcgccctgatcccgctgggcggctacgtcaaaatgctggatgagcgcgccgaaccggta
gcgccggaattgcgtcgtcacgccttcaataacaaaacggtgggccagcgtgccgcaatt
attgccgcaggtccggttgcgaacttcatttttgctatctttgcttactggctggtcttt
atcatcggcgtccctggcgttcgtccggtcattggcgaaataacgcccaactcgattgct
gcgcaggcgcaaattgcgcctggtacggaacttaaagccgttgatggtatcgaaacccct
gattgggatgccgtgcgtttacaactggtgtccaaaattggcgatcagcagacgacggtg
agcgtcgcgccgtttggcagcgaccagcggcaggacaaaacgcttgatttacgtcactgg
gcatttgagcctgataagcaagatcctgtatcttctttagggattcggccccgcgggcca
cagattgaaccggtactgtcagaagtgcaggcgaattccgcagccagtaaagcgggtttg
caagcaggcgacaggatcgttaaagtcgatggtcagccgttaacgcagtggatgaaattc
gtgacgtttgtacgtgataatcccggtaagccgttagcgttagagattgaaaggcagggg
agcgccttgtcgttgacgttaacgccggatacgaaatcggttaacggaaaggcggaaggg
tttgcaggcgtggtgcctaaaattattcctctgccggaagagtacaagactatacgccag
tatgggccttttagcgccatcctcgaagccacggataagacgtggcagttgatgaagctg
acggtcagtatgctgggtaaattgataaccggtgatgtgaaactgaacaacctcagtggg
ccgatttctatcgctcagggggctgggatgtcagcggagttcggggtgatttattacctg
atgttccttgcgctaatcagcgtgaacttagggataattaacctgtttccgctgcccgtt
cttgacgggggtcatctgctgttcctggcgattgaaaagcttaagggcgggccggtatcc
gagcgggttcaagactttagttatcgcattggctcgattttgctggtgttgttaatgggg
cttgcacttttcaatgatttctctcggttgtaa

DBGET integrated database retrieval system