KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0226Help
Entry
SSPA0226          CDS       T00756                                 

Definition
(GenBank) (3R)-hydroxymyristol acyl carrier protein dehydrase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00061  Fatty acid biosynthesis
sek00780  Biotin metabolism
sek01100  Metabolic pathways
sek01212  Fatty acid metabolism
Module
sek_M00083  Fatty acid biosynthesis, elongation
sek_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SSPA0226
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SSPA0226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sek01004]
    SSPA0226
Enzymes [BR:sek01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SSPA0226
Lipid biosynthesis proteins [BR:sek01004]
 Fatty acid synthase
  Component type
   SSPA0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: CAR58340
UniProt: B5BAN7
Position
270722..271177
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagagcttctgccgcaccgt
tttccgtttttactggtcgatcgcgtgctggactttgaagaaggtcgttttctgcgtgca
gtgaaaaatgtctccgtcaacgagccgtttttccaggggcatttcccgggcaaaccgatt
ttgccaggcgtgctgattctggaagcgatggcgcaggcaaccggtattctggcgtttaaa
agcgttggtaaactggaacctggcgaactgtattatttcgcgggtattgatgaagcgcgc
tttaagcgtccggtggtgccaggcgatcagatgatcatggaagtcactttcgagaaaacg
cgccgtggcctgacccgctttaaaggggttgcgctggtcgacggtaaagtcgtgtgcgaa
gcaaccatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system