KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0228Help
Entry
SSPA0228          CDS       T00756                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00540  Lipopolysaccharide biosynthesis
sek01100  Metabolic pathways
Module
sek_M00060  Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SSPA0228
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sek01003]
    SSPA0228
   01005 Lipopolysaccharide biosynthesis proteins [BR:sek01005]
    SSPA0228
Enzymes [BR:sek01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     SSPA0228
Glycosyltransferases [BR:sek01003]
 Polysaccharide
  Bacterial polysaccharide
   SSPA0228
Lipopolysaccharide biosynthesis proteins [BR:sek01005]
 Lipid A
  SSPA0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-ProteinID: CAR58342
UniProt: B5BAN9
Position
271969..273117
Genome map
AA seq 382 aa AA seqDB search
MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEEL
AVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIHY
VSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVPCRFIGHTMADAMPLDPDKNA
ARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQRYPDLEVVVPLVNAKRREQ
FEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKCPMVVGYRMKSFTF
WLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLANGKTSHAMHDTFRE
LHQQIRCNADEQAADAVLELAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagcgtcctttaacgattgccctggtcgccggtgaaacgtccggcgatatt
cttggcgcaggcttaattcgtgcgctgaaagcgcgcgtacccaacgcccgttttgtgggc
gttgcggggccgcgtatgcaggccgaagggtgtgaagcttggtacgaaatggaagagctg
gcggtcatgggcattgttgaagtgctcggacgtttacgccgtttgttgcatatccgcgcc
gatctgacccgccgttttaccgaactcaagcccgatgtctttgtcgggattgatgcccct
gatttcaatattaccctcgaaggtaatctgaaaaaacaagggattaagaccattcattat
gtcagcccgtccgtttgggcctggcgacagaaacgcgttttcaaaataggcagatccacc
catatggtgttggcttttctgcctttcgaaaaagcgttttacgataaatttaacgtcccg
tgccgctttatcggtcacaccatggcggatgccatgccgctggacccggataaaaatgcg
gcgcgcgacgtgctgggtatcccgcatgacgcccattgtctggcgctactgccaggcagc
cgtggcgcggaagtggaaatgctcagcgccgatttcctgaaaaccgcacaattgctgcga
cagcgctatcccgatctggaagtggtagtgccgctggtgaacgcgaaacgccgcgagcag
tttgaaaaaattaaagcggaggttgcgccggatctcgccgttcatttgctggacggcatg
gcgcgcgaggcgatgatcgccagcgacgcggctctgctggcctcgggtacggcggcactg
gagtgtatgctggcaaaatgcccgatggtagtgggatatcgtatgaagtccttcactttc
tggctggcgaaacgtctggtgaaaacggagtatgtgtctttgcctaacctgctggcggga
agagaattagtcaaagagctgttgcaggaagagtgcgaaccgcaaaaactcgccgaagcg
ctgttgccgctactggcgaacggtaaaaccagccatgcgatgcacgacaccttccgtgag
ctgcatcagcagatccgctgtaatgccgatgagcaggcggcagatgccgtcctggagtta
gcacaatga

DBGET integrated database retrieval system