KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0232Help
Entry
SSPA0232          CDS       T00756                                 

Definition
(GenBank) putative secreted chitinase
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_19
Motif
Other DBs
NCBI-ProteinID: CAR58346
Position
278367..280130
Genome map
AA seq 587 aa AA seqDB search
MGLQKTLALSAVAAGIMLSLSGAQAAPLLSSSEPMTINASDLAVKEKALTDFPLMEAVKS
SIQTLDNSAVEQIEPGRAANPANVKRVESILKEADWDYLFPMRAPEYTYSNFLKAIGKFP
AVCGTYTDGRDSDAICRKTLATMFAHFAQETGGHESWRDIPEWRQALVYLREVGWTEGQK
GGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNYNYGPFSDAMYGDVRPLLD
KPELVADTWMNLASAVFFFVYPQPPKPSMLHVIDGTWQPNDRDKANGLVSGFGVTIQIIN
GGVECGGADENAQSLNRIAYYKEFANYLKVPVPADEVLGCKKMKQFDEGGAGALPIYWEQ
DWGWSADTADGKTYSCQLVGYQTPYTAFKEGDYTKCVQHYFNVNVVDDNGTTEPDVTPTP
APVTDENVAPVARIAGPVGAVEAGSPVSLSAEGSTDANGDKLTCTWMSQDGKTLSGQDKA
VVIFNAPDVAQNTQYVVNLTVSDGTLSSTAVYTLNVKAKAAAADDEDKTTSYPAWSSSQK
WNPGDIVNSNGALYQCKPFPEGSWCNVAPAYYEPGVGIAWADAWNAL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggattgcaaaaaacactggcgctcagcgccgtagcggcagggatcatgttgagctta
tccggtgcgcaggccgcgccgctgcttagcagtagtgagccaatgaccattaacgccagc
gatctggcggtgaaagagaaagcgctaacggattttccgttaatggaggccgtgaaatcc
tctattcagacgttggataacagcgcggttgaacaaatcgaaccggggcgcgccgctaac
ccggcaaacgtaaaacgcgttgaaagtattctgaaggaggccgactgggattatctgttc
ccgatgcgcgcgccggaatacacttactctaacttcctgaaagcgataggtaaattcccg
gcggtttgtggtacctacaccgatggacgcgatagcgacgctatctgccgtaaaaccctg
gctactatgtttgcgcattttgctcaggagacgggcggtcacgaaagctggcgtgacatt
ccggaatggcgtcaggcgctggtctatctgcgcgaagtcggctggactgaagggcagaaa
ggcggctacaacggcgaatgtaacccggatgtatggcagggccagacctggccgtgcggt
aaagataaggacggcgatttcctcagctattttggtcgcggggcaaaacagctttcttat
aactacaactatgggcctttctctgacgcgatgtatggcgacgttcgccctctgctggat
aaacccgagctggtggcggatacctggatgaacctggcgagcgccgtcttcttctttgtg
tatccgcagccgccgaagccgtctatgctacatgtgattgacggtacctggcagccaaac
gatcgcgataaagcaaacggcctggtatcaggtttcggcgtcactattcagatcatcaat
ggcggcgtggagtgcggcggcgcagatgagaatgcgcagtcgcttaaccgtatcgcctac
tacaaagagtttgccaactacctgaaagtgccggtgccggctgacgaagtgttgggctgt
aaaaagatgaagcagttcgatgaaggcggcgctggcgcgttaccgatctattgggaacaa
gactggggctggagcgccgatactgcggacggtaaaacctattcctgccagttagttgga
tatcagacgccgtataccgcctttaaagagggcgactacacgaaatgtgtacagcattat
ttcaacgttaatgtcgtcgatgataacggaaccactgaaccggatgtcacgccaactccg
gcgccagtgacggatgaaaacgtggcgccagtcgcgcgcattgccgggccggtcggggca
gtggaagccggtagcccggtttcactcagcgcggaaggatcgaccgacgcgaatggcgac
aagctcacctgtacctggatgtctcaggatggcaaaacgctgagcggccaggataaagcc
gttgtcattttcaacgcgccggatgtcgctcagaacacccagtatgtggtgaatctgacc
gttagcgacggtacgctctccagtacagcggtttatacgctgaatgtgaaagcgaaggcc
gccgctgcggatgacgaagataagaccaccagctatcctgcctggagcagcagccagaaa
tggaatccgggcgacatcgtcaacagtaatggcgcgttgtaccagtgcaaaccgttcccg
gaaggctcatggtgtaatgttgcgcctgcctattatgagcccggtgtagggattgcctgg
gccgatgcatggaacgcattgtaa

DBGET integrated database retrieval system