KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0234Help
Entry
SSPA0234          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K08234  glyoxylase I family protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    SSPA0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_2 Glyoxalase_6
Motif
Other DBs
NCBI-ProteinID: CAR58348
Position
282403..282792
Genome map
AA seq 129 aa AA seqDB search
MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEVWREERDSWKGDLALNGQYVIELFS
FPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIRIDPYTGKRFTFFNDPD
GLPLELYEQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgctgggattaaaacaggttcatcacatcgcgatcattgcgacagactatgcggtgagc
aaggcgttttattgcgatattctggggttcgatctgctaagcgaagtctggcgggaagag
cgtgactcgtggaagggcgatttggcgctaaacgggcagtatgtgattgagcttttctct
tttcccttccctccggcgcgtccaagccgacctgaagcctgtggcctgcgccatctggct
ttcagcgtggaaaatgtggaaaacgccgttgcgcatctggaaaagcatcaggttaagtgc
gaaccgatacgcatcgatccgtataccgggaagcgctttacttttttcaacgatccggac
ggtttaccgcttgagctgtatgagcagtaa

DBGET integrated database retrieval system