KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0236Help
Entry
SSPA0236          CDS       T00756                                 

Definition
(GenBank) ROF protein
  KO
K19000  Rho-binding antiterminator
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sek03021]
    SSPA0236
Transcription machinery [BR:sek03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     SSPA0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROF
Motif
Other DBs
NCBI-ProteinID: CAR58350
Position
complement(284231..284485)
Genome map
AA seq 84 aa AA seqDB search
MNETYQPINCDDYDSLELACMHHLILTLTLKNGEVLQAKANDLILRKNVEYLLAEVSGES
CELRLDKIASFSHPEIGTVVVSES
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacgtatcaacccattaattgcgatgactacgatagtcttgagcttgcctgc
atgcatcatttaatactgacgctaacgttaaaaaatggcgaggttttgcaggcaaaagcg
aacgatttgatcttacgtaaaaacgtagaatatctgcttgccgaagtttccggcgagtct
tgtgagcttcgtctcgataaaatcgccagtttcagccacccggaaattggtaccgtggta
gttagcgaatcctga

DBGET integrated database retrieval system