KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0237Help
Entry
SSPA0237          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0253 Tox-REase-7
Motif
Other DBs
NCBI-ProteinID: CAR58351
Position
complement(284478..284696)
Genome map
AA seq 72 aa AA seqDB search
MLTGGHVEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAADSALSESVREKAAYA
AANLLVSDYVNE
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgctgacaggagggcatgtggaaaaatattgtgagttagtacgcaagcggtatgcggaa
atcgccagcggagacttagggtatgtcccggatgcgctgggttgtgtattgaaagtgctt
aatgaagtggcggcagatagcgccctttcagagtcggtcagggaaaaggcagcttatgct
gccgcgaacttactggtgagcgattatgtcaatgaatga

DBGET integrated database retrieval system