KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0239Help
Entry
SSPA0239          CDS       T00756                                 

Definition
(GenBank) putative release factor
  KO
K15034  ribosome-associated protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sek03012]
    SSPA0239
Translation factors [BR:sek03012]
 Prokaryotic Type
  Release factors
   SSPA0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RF-1 DUF3886
Motif
Other DBs
NCBI-ProteinID: CAR58353
Structure
PDB: 

Position
285418..285840
Genome map
AA seq 140 aa AA seqDB search
MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSGAIHLRFDIRASGLPEYYKQRLLTAS
HHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLS
SKAQKSSVKVLRGKVRRPLD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgattgccatctcccggacggtctccatagccgataatgagctggaaattacggccatt
cgcgcgcagggcgcgggtggtcagcacgtaaataagacctctggcgcgattcatttgcgc
tttgacattcgggcctctggcctgccagagtattataaacagcgtttgctgacggccagc
caccatctgataagcgatgatggcgtcattatcattaaggcgcaggagttccggagccag
gagctcaaccgggaagcggctatcgccaggctggttgccgtcataaaagaattaaccgcg
gagcagaaaagccgtcgcgcaacccgtccgacgcgtgcctcgaaagagcgccgcttgtcc
tcaaaggcgcaaaaatcttctgtaaaggtgcttcgcggcaaagttcgtcgtccactggat
tga

DBGET integrated database retrieval system