KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0243Help
Entry
SSPA0243          CDS       T00756                                 

Definition
(GenBank) RcsF protein
  KO
K06080  RcsF protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSPA0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsF DUF4156
Motif
Other DBs
NCBI-ProteinID: CAR58357
Position
complement(289180..289584)
Genome map
AA seq 134 aa AA seqDB search
MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPRAAPVRIYTNAEDLVG
KPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAVLLHSCEITSGTPGCYR
QAVCIGSALNISAK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctttaccgatctgtttattggcactcatgctgggcggttgttccatgctaagc
agatcccctgttgaacccgttcaaagcaccgcaaccccgccaaaagcggagccggagaaa
cctaaagcgccgcgtgccgctcccgtcaggatttacaccaatgctgaagacttagtcggc
aaacctttccgcgatcttggcgaggttagcggcgaatcctgccaggcgacaaatcaagac
tctccgcctaacattccaactgcgcgcaagcgtatgcagattaatgcatctaaaatgaaa
gccaacgccgtcctgctgcacagctgtgaaattaccagcggcacgccaggctgctatcgt
caggcggtttgtatcgggtccgccctgaatatttcggcgaaatga

DBGET integrated database retrieval system