KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0245Help
Entry
SSPA0245          CDS       T00756                                 

Definition
(GenBank) putative ABC transporter permease protein
  KO
K02072  D-methionine transport system permease protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek02010  ABC transporters
Module
sek_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSPA0245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sek02000]
    SSPA0245
Transporters [BR:sek02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    SSPA0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CAR58359
Position
complement(290557..291195)
Genome map
AA seq 212 aa AA seqDB search
MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIMENARLYRSLSAVVNIFRS
IPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPAGLIEASRA
MGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYN
ATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtggttactggttcgtggcgtttgggaaacgttggcgatgacctttgtctccggtttc
ttcggtttcgtgattggcctgccggttggcgtattgctgtatgttacgcgcccggggcag
attatggagaacgccaggctgtatcgctccctctctgcggtggtcaatattttccgctcg
attccctttatcatcctgctggtgtggatgattccttttacccgaataattgtcggcacc
tccattggtttgcaggccgcgattgtaccgctgaccgtcggcgccgcgccttttatcgcc
cgtatggtggaaaatgcgttgttagagatccctgccgggctgattgaagcctcgcgagcg
atgggcgccacgccgctgcaaattgtacgtaaaatccttttaccggaagcgctgcctggt
ctggtaaatgcggcaaccattacactgatcaccctggtcggttactccgcaatgggcggc
gccgtcggcgcaggcggcctcggtcaaatcggctatcagtacggttatattggatacaat
gctaccgtgatgaatacggtgctggtattacttgtcgttctggtttatttaattcagtta
tccggcgatcgcatcgtcagggctgtcacgcataagtaa

DBGET integrated database retrieval system