KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0248Help
Entry
SSPA0248          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4385
Motif
Other DBs
NCBI-ProteinID: CAR58362
Position
298958..299413
Genome map
AA seq 151 aa AA seqDB search
MAIKPFNYQQDFSSIDFRQQPELYQVGRGEQGVLLVEPYKSEILPFWRYKDEASAMKSAE
QIYQLFEAYRQQDDFVGMDMARKFIQMGYTRARRYANYKGGKKYAEDGSLNTRGNDPIKA
AAATVFKGWWDKIRQDEDYLKRKRQHQARWG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttggctatcaaaccttttaactaccagcaagacttttccagcattgacttccgccagcag
cctgaattgtatcaggttggacgaggagagcagggggtgctactggttgaaccctacaaa
agcgaaattcttcctttctggcgctataaagatgaagcatcggcgatgaaatccgcagaa
cagatctaccagttgttcgaagcttaccggcagcaggatgatttcgttggtatggacatg
gcgcgtaaatttattcagatgggatacacccgcgccaggcgatacgctaactataaaggt
ggtaaaaagtatgcagaagacggcagcctgaatacacggggtaatgatcctattaaggcc
gcggcggcaacggttttcaaaggttggtgggataaaatccgtcaggacgaagactatctg
aaacggaaacgccagcatcaggcacggtggggataa

DBGET integrated database retrieval system