KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0249Help
Entry
SSPA0249          CDS       T00756                                 

Definition
(GenBank) alpha-ketoglutarate permease
  KO
K03761  MFS transporter, MHS family, alpha-ketoglutarate permease
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sek02000]
    SSPA0249
Transporters [BR:sek02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    SSPA0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_2 AzlD
Motif
Other DBs
NCBI-ProteinID: CAR58363
Position
299517..300818
Genome map
AA seq 433 aa AA seqDB search
MAEIIQRIDKNNAEAPEMRRRIWAIVGASSGNLVEWFDFYVYSFCSLYFAHIFFPSGNTT
TQLLQTAGVFAAGFLMRPIGGWLFGRIADRRGRKASMLISVCMMCMGSLVIACLPGYDTI
GTWAPALLLIARLFQGLSVGGEYGTSATYMSEVALEGRKGFFASFQYVTLIGGQLLALLV
VVILQQVLEDAELRAWGWRIPFALGAVLAVVALWLRRQLDETSKHETRALKEAGSLKGLW
RNRKAFLMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANVASGIMTAALCVFMLVQPLF
GALSDKIGRRTSMLCFGALATLFTVPILSALQNVTSPYAAFALVMCALLIVSFYTSISGI
LKAEMFPAQVRALGVGLSYAVANALFGGSAEYVALSLKSVGMESSFFWYVTAMAVLAFLV
SLMLHRKGKGLRL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattattcagcgtatagataaaaacaacgctgaggctccggagatgcggcga
cgcatatgggctatcgtgggggcctcttccggaaacttagtggaatggtttgatttctac
gtctactctttctgctcgctctattttgcacatatcttctttccttctggtaataccact
actcagcttttgcaaacggcaggcgtctttgccgccggttttttaatgcggcctatcggt
ggttggctgtttggacgcattgccgatcgacgcgggcgcaaagcctcaatgttgatttcg
gtgtgcatgatgtgcatggggtcgctggtgattgcctgcttacctggttacgataccatc
ggcacctgggcaccggcgctgctacttattgcaaggttatttcaggggctctcggtaggg
ggagagtatgggaccagcgcgacatatatgagtgaagttgcgcttgaaggtcgtaaggga
tttttcgcgtcgtttcagtacgttacgcttatcggtggccaactactggcattgctggtc
gttgtgattttgcagcaggttctggaggatgctgagcttcgtgcctggggatggcgtatt
ccctttgcgctgggcgccgtgctggcggttgtggcgttatggctacgtcgccagctggat
gaaacctcgaagcatgagactcgcgcattaaaagaagccggttcgttgaaaggtttgtgg
cgtaatcgcaaagcctttttgatggtgcttggtttcaccgcggcaggctcgctgtgcttt
tataccttcaccacctatatgcagaaatatctggtaaatacagcaggtatgcatgccaat
gtcgccagcggcattatgacggctgcgctgtgtgttttcatgttggtgcagccgttattc
ggcgcgttatccgataagattggcaggcgcacctctatgctatgttttggcgcgctcgcg
acgcttttcaccgttccaattctctccgcgttgcagaatgtgacgtcgccttatgccgca
tttgctttagtgatgtgcgcgctattgattgtgagtttctatacctcgattagcgggatc
ctgaaagcggagatgtttccggcgcaggttcgcgccctgggcgtcggtttatcttacgcg
gtagcaaacgcgttatttggcggctcagcggaatatgttgcgctgtcgctaaaatctgtc
ggtatggagagttcgttcttctggtatgttaccgcgatggccgttctggctttcctagtt
tcgctgatgttgcaccgtaaaggaaagggcttacgcctttag

DBGET integrated database retrieval system