KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0361Help
Entry
SSPA0361          CDS       T00756                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00300  Lysine biosynthesis
sek01100  Metabolic pathways
sek01120  Microbial metabolism in diverse environments
sek01230  Biosynthesis of amino acids
Module
sek_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSPA0361
Enzymes [BR:sek01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SSPA0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: CAR58484
UniProt: B5BB22
Position
complement(451978..453105)
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEIIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgcaggctgtcaggcattaatgattgaacgcctgcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgaacctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcgcagcatcctcat
caccggggccgtctcgcatttttgattacctctgatgaagaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggtgatgtcgtcaaaaacgggcgtcgcggttcc
ctcacctgtaacctcactattcatggcgttcaggggcacgtcgcctatccgcatctggcg
gataaccctgttcatcgcgctgcgccttttcttaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcaggtagccaatatccaggcaggcacc
ggcagcaataatgttattcccggcgaactgttcgtgcagtttaacttccgttttagcacg
gaactgaccgatgagataatcaaagaacgggtacatgcgctgcttgagaagcatcagcta
cgttataccgtagactggtggctttccggccagccgttcctgaccgcacgcggcaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaatgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgcattatggaacagctcgtcgcctga

DBGET integrated database retrieval system