KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1654
Entry
SSPA1654          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09911  uncharacterized protein
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SSPA1654
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: CAR59846
UniProt: B5BBL1
Position
complement(1832613..1833065)
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYVEASAAQEAVNLLLALENEPVRVNVWIDR
HMNPALLNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAQRRGKTLSETIV
QLIEDAEHKEKYATQMTTLKQDLQALLGKK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaaatatctggtgaaa
aagcaccgcgaaggggagttgatcacccgctacgtggaagccagtgctgcccaggaagcc
gtcaatttgttgttggccctcgaaaatgaaccggtgcgggtaaatgtctggatagacagg
catatgaatcctgccttgcttaatcggatgaaacaaaccattcgggcaagacgcaaacga
cacttcaatgcggaacatcagcatacgcgcaaaaaatctatcgatttagagtttatggtc
tggcagcgtctggcgggccttgcgcagcgacgcggtaaaacattatccgaaacgattgtg
caactgatagaagacgcggagcataaagagaaatatgccacgcaaatgaccacgttaaag
caggatttacaggcgttattaggcaagaagtaa

DBGET integrated database retrieval system