KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1847Help
Entry
SSPA1847          CDS       T00756                                 

Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00010  Glycolysis / Gluconeogenesis
sek00260  Glycine, serine and threonine metabolism
sek00680  Methane metabolism
sek01100  Metabolic pathways
sek01110  Biosynthesis of secondary metabolites
sek01120  Microbial metabolism in diverse environments
sek01130  Biosynthesis of antibiotics
sek01200  Carbon metabolism
sek01230  Biosynthesis of amino acids
Module
sek_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sek_M00002  Glycolysis, core module involving three-carbon compounds
sek_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSPA1847
  Energy metabolism
   00680 Methane metabolism
    SSPA1847
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSPA1847
Enzymes [BR:sek01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSPA1847
Membrane trafficking [BR:sek04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SSPA1847
Exosome [BR:sek04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSPA1847
  Exosomal proteins of melanoma cells
   SSPA1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAR60044
UniProt: B5BC52
Position
2058139..2058891
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWTDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaacgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggccgaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaccgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaataccttgataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system