KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2317
Entry
SSPA2317          CDS       T00756                                 

Definition
(GenBank) putative membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SSPA2317
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sek02044]
    SSPA2317
Secretion system [BR:sek02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SSPA2317
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CAR60547
UniProt: A0A6C7I4S7
Position
complement(2581530..2582834)
AA seq 434 aa
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAA
ANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRY
CLCTALDEAANNTTWGRRGVWAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEV
IYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRRDPVMPALSPDFQGAISGRLRRM
RRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDAIGIKLPPPPVPVHKLRLKIL
LANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAAREIARVGGAVTV
TGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgacagacagtaccctgacgccgccagcggcggacatgatgtcctttttgtccaccacg
ccggaacataaggacagtgaatatgaaacgccggtacacaccagccagcgcacggaactc
aatgtcatcgttgaagacggtccggacagcaaactccggctggctgaaatcagcgcggcg
gctaacccgttgctcgccgctgcccggcctttattgtgcgctctcgcagccatgcccgct
aaactggatgcggccctggtagagccttaccgtaatctgctggtacgcgagatgcatctg
taccagacattatgcgatcaggcgaacctgcggcgcgagcacgtactggcggtacgttac
tgcctgtgtacggcgcttgatgaagccgccaataacacaacctggggacggcgcggcgtc
tgggccggaaaaagcctgctggtaacatttcatggtgaaagcgaaggcgggataaaactt
ttccagatcatcgggcgtctggcggccagcttccaggaacatggcaacgtactggaggtt
atctaccacctgctggggctgggatttgaaggccgctacagcgtgcagccagacgggcgt
aagcaactggacaatattcgtcagcaactgctgacacagctttcacagcgtcgcgatccg
gtcatgcccgcgctctcgcctgactttcagggggcgataagcggacgactgcggcggatg
cgccgggtgccggtctggctgagcgccgggatagccctgttggcgatgctgacgctgttt
ggcctttacagccaccggatggatgtgcagaccgtcaccgtacaacagcatattgatgcg
attggtataaaactgccgccgccgcccgtgccggttcataagctgcggctgaaaatcctg
ctggcaaacgaaatcgcccgtggcctgctgaccgtggacgaagatgaccagcacagtagg
gtggtcttccgtggcgacgccatgtttgtaccgggacaaaaaacggtgagtgacgcaatc
cggccagtgattaacaaagcggcgcgggaaatcgcccgcgtgggcggcgcagtcactgta
acgggtcacactgacagccagcccattcattcggctgaattcccatccaacctggtgctg
tcggaaaaacgggcggcggaagttgcggcgttgctgacctccggcggcgtacctgccgga
cgggtacatatcgtcggcaagggcgatacggtgccggtggcggataacggcagtaaagcc
gggcgggcgaaaaaccgtcgggtggaaattctggtagtggagtga

DBGET integrated database retrieval system