KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2319
Entry
SSPA2319          CDS       T00756                                 

Definition
(GenBank) probable lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sek00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SSPA2319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sek02044]
    SSPA2319
Secretion system [BR:sek02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SSPA2319
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CAR60549
UniProt: A0A6C7I3B6
Position
complement(2584178..2584714)
AA seq 178 aa
MNKWRNPTGWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAP
IEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTA
IGVLAGYRNLTKSVWRVTYKIPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgaataaatggcgtaaccccactgggtggttatgtgcggtagctatgccttttgcactg
ctcctgctttccggatgcggcagtagcgatgcgttacctgacctcgaatcacagcgcctc
gacctgagcgtgaaagcctccgataaggtgaatcctgacaatcagaagaaggccgcgccc
attgagatacgtgtttatgaactaaaaaatgacgccgctttcacgacagccgattactgg
tcgctccatgacaacgacaaatccgtccttaccgacgatttagtgcgtcgcgacagcttt
attttgcgtcccggcgaagagaaaaaactgcgtcgcccgctgaatgcgcagaccacggca
atcggcgtactggccggataccgtaacctgaccaaatcggtctggcgggtaacctacaaa
atcccggaagccccggaaaaagcctggtacagcagcttcataccggggaaaggaaaagtg
cagttggaggcggaactggaacaaagcgccattgtaattacggaacgggataaatga

DBGET integrated database retrieval system