KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2326
Entry
SSPA2326          CDS       T00756                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sek02044]
    SSPA2326
Secretion system [BR:sek02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SSPA2326
SSDB
Motif
Pfam: VipB VipB_2 Pro_3_hydrox_C
Other DBs
NCBI-ProteinID: CAR60556
UniProt: A0A6C7I1U2
Position
complement(2588206..2589714)
AA seq 502 aa
MANSNMQATDAVAQDTVSASGEFDALLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITV
SDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFM
NLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLL
GSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSR
YIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAAYAMGVNINRSFKHYG
WCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKN
SDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDIQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQ
LEGLTGSLRLVTKLPSVKQGNA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcaaacagtaatatgcaggcaaccgacgcggttgctcaggataccgtctccgcatcc
ggtgaatttgatgcgttgctgaatcaggccttccgacccaagactacccaggcggcaaaa
gccgtggaagccgcggtgcagacgctggcgcaacaggcgctggcgaacacgatcacagtc
agcgatgacgcttataaaagcatcagcgctattattgcgcagatcgactttaaactgacc
gaacagatcaaactgatcctgcaacatcccgactggcagaagctggaatcctcgtggcgc
ggtatggagcatttggtttacaacaccgagaccgacgaaaagctgaaaatccgcttcatg
aatctgtcaaaagatgaattgcggcgcaacatgaagcgttacaagggcatcgcctgggat
caaagcccgatgttcaagaaactgtatgaagccgaatacggccagttaggtggcgaacct
tatggctgtatcattgcggattactacttcgaccatacaccgcccgatgtggatctgctt
ggctctatcgccaaagtcgccgcgtcggcccatgcgccgtttattgccggggcttccccc
tcggtactgcaaatggactcctggcaggagctggcgaatccccgcgacctgaccaaaatc
gtcacccagaacctggaatatgcgccgtggaactcgctgcgggctagcgaagactcccgt
tatattggcctgacgatgccgcgttttcttgcccgcctgccgtatggcgcaaaaaccaac
ccggtggacgagtttgattttgaagaagatgcggatggttctgaccataccaaatacgtc
tggagcaacgcggcctacgcgatgggcgtaaacatcaaccgttccttcaaacactacggc
tggtgtacgttgattcgcggtgtggaatcaggcggtgcggtggaaaatcttccctgccat
accttcccgactgacgatggcggcgtggacatgaaatgcccgaccgaaatcgccatctct
gaccgccgcgaggctgaactggcgaaaaacggttttatcccgttgatccaccgtaaaaac
tcagactatgccgcctttatcggcgcacaatcgctgcaaaaaccacaggaatactacgat
ccggacgcgacggccaacgccaacctgtccgcccgtctgccgtacctgttcgcctgctcg
cgcttcgctcacttcctcaaatgtatcgtccgcgacaaaatcggttcctttaaagagcgt
gaggatatacagcgctggctaaatgaatggattatgaattacgtcgacgccgatccggtg
aactcctcgcaagaaactaaagcccgtcgtccgctggctgccgctgaagtagtggtggaa
gaggtggaaggcaatccaggttattacgacgcgaaattcttcctgcgtccgcatttccag
cttgaagggctgacgggatcgctgcgcctggtgacaaaactgccgtcagtgaagcagggc
aatgcctga

DBGET integrated database retrieval system