KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2327
Entry
SSPA2327          CDS       T00756                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sek02044]
    SSPA2327
Secretion system [BR:sek02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SSPA2327
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAR60557
UniProt: A0A6C7I4T6
Position
complement(2589738..2590280)
AA seq 180 aa
MAINNSAQKFIARNRAPCVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDR
KFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALN
QLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctatcaacaatagtgcgcagaaattcatcgcgcgcaaccgcgcgccgtgcgtgcag
attgaatatgacgtagagatttacggctctgagaaaaaaatcgagctgccgttcgtgatg
gcggtgctggccgatctggccgggaaaccgcgtgaagaactgccgccggtgacggatcgc
aaattcctcgatattgatattgataacttcaatgagcgtatgaaagccattgcgccgcgc
gtggcgttcgccgtgccgaatacgctgacgggtgaaggtcagttgatggtcgatatcacg
ctggaaaatatggacgacttttcgccggcacagattgcccgcaaggtggacgccctgaac
cagttactggaagcccgcactcaactggcgaacctccagacctacatggatggcaaggcg
ggggcggaaaatctggtcaataaactgttgcaggacccgactctgctgaaaacgctggcg
aatgcgccgaaatcggccgctacccagcaagatgtgtcagcggataatgaatcagcggaa
taa

DBGET integrated database retrieval system